Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MD08

Protein Details
Accession T0MD08    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
8-34EHEFKWSPCNPKKSKHCEYLNLRKRCNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, nucl 8, mito 1, cyto 1, pero 1, E.R. 1, golg 1, cyto_mito 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR040202  Brl1/Brr6  
IPR018767  Brl1/Brr6_dom  
Gene Ontology GO:0031965  C:nuclear membrane  
GO:0055088  P:lipid homeostasis  
GO:0006998  P:nuclear envelope organization  
Pfam View protein in Pfam  
PF10104  Brr6_like_C_C  
Amino Acid Sequences MNLPMDFEHEFKWSPCNPKKSKHCEYLNLRKRCNEDINLDNKPILKSLPLNAQIKKQKIEYKKFDFFKLVAHIYKYLFILTDIVLSLILAYLFAQAFIFLQKDIMHKITQKKFELEIIKKEAQNNYSVNMCNMRVPAMNKMCNEWENIIKNGNIKYTSVLFEVFSDVCNNFIGRISWKSILVLSIFFIIYLKYYRFYRNINA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.53
4 0.56
5 0.65
6 0.75
7 0.78
8 0.81
9 0.81
10 0.79
11 0.79
12 0.83
13 0.84
14 0.83
15 0.82
16 0.76
17 0.72
18 0.69
19 0.66
20 0.63
21 0.57
22 0.53
23 0.52
24 0.56
25 0.53
26 0.49
27 0.43
28 0.38
29 0.34
30 0.28
31 0.21
32 0.17
33 0.16
34 0.19
35 0.25
36 0.3
37 0.34
38 0.35
39 0.43
40 0.47
41 0.49
42 0.48
43 0.45
44 0.47
45 0.52
46 0.6
47 0.6
48 0.62
49 0.67
50 0.66
51 0.63
52 0.58
53 0.48
54 0.42
55 0.38
56 0.33
57 0.26
58 0.25
59 0.25
60 0.22
61 0.23
62 0.19
63 0.14
64 0.11
65 0.1
66 0.09
67 0.07
68 0.07
69 0.06
70 0.05
71 0.05
72 0.05
73 0.04
74 0.03
75 0.03
76 0.02
77 0.03
78 0.03
79 0.03
80 0.04
81 0.04
82 0.04
83 0.04
84 0.04
85 0.05
86 0.04
87 0.05
88 0.06
89 0.07
90 0.09
91 0.1
92 0.11
93 0.15
94 0.24
95 0.29
96 0.34
97 0.35
98 0.35
99 0.34
100 0.38
101 0.42
102 0.37
103 0.36
104 0.36
105 0.38
106 0.38
107 0.4
108 0.38
109 0.31
110 0.32
111 0.27
112 0.22
113 0.22
114 0.21
115 0.19
116 0.18
117 0.17
118 0.15
119 0.14
120 0.14
121 0.14
122 0.16
123 0.23
124 0.26
125 0.3
126 0.29
127 0.31
128 0.33
129 0.31
130 0.32
131 0.26
132 0.26
133 0.25
134 0.26
135 0.26
136 0.24
137 0.26
138 0.26
139 0.26
140 0.21
141 0.18
142 0.2
143 0.2
144 0.2
145 0.18
146 0.17
147 0.14
148 0.14
149 0.16
150 0.14
151 0.12
152 0.13
153 0.12
154 0.12
155 0.12
156 0.12
157 0.1
158 0.11
159 0.12
160 0.14
161 0.17
162 0.21
163 0.22
164 0.22
165 0.23
166 0.22
167 0.22
168 0.19
169 0.16
170 0.13
171 0.12
172 0.12
173 0.11
174 0.1
175 0.08
176 0.09
177 0.12
178 0.12
179 0.15
180 0.18
181 0.24
182 0.29