Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L589

Protein Details
Accession T0L589   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-53FNDFFKLRKRLKNYKYFKLEKEHydrophilic
145-166ETVIIRQKRRSNKKINLLLKSKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, nucl 13, cyto 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR029071  Ubiquitin-like_domsf  
Amino Acid Sequences MAFTVLFSDDEDTKKQIAESIFTLFHLKNNIFNDFFKLRKRLKNYKYFKLEKELLYTKSEVTKCPICDEFIIGIHEHLKKDLINSKVTILFDTNVTTENKHIIVDEMSVKEIKNLVYDKTGLSVSKQEVIRNNEILNNHVIVKGETVIIRQKRRSNKKINLLLKSKIFLSPTSKAKILTPIKSALQKSNRNTFKFLKEIQNIVDNTNKENMKDWEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.22
4 0.21
5 0.21
6 0.2
7 0.21
8 0.21
9 0.21
10 0.25
11 0.2
12 0.21
13 0.24
14 0.23
15 0.25
16 0.28
17 0.31
18 0.3
19 0.3
20 0.34
21 0.33
22 0.35
23 0.36
24 0.41
25 0.44
26 0.51
27 0.59
28 0.64
29 0.69
30 0.77
31 0.78
32 0.8
33 0.82
34 0.8
35 0.74
36 0.72
37 0.68
38 0.59
39 0.58
40 0.53
41 0.46
42 0.42
43 0.39
44 0.32
45 0.34
46 0.33
47 0.27
48 0.27
49 0.3
50 0.28
51 0.31
52 0.31
53 0.25
54 0.24
55 0.25
56 0.21
57 0.17
58 0.18
59 0.14
60 0.13
61 0.16
62 0.17
63 0.15
64 0.14
65 0.14
66 0.13
67 0.16
68 0.22
69 0.2
70 0.2
71 0.21
72 0.22
73 0.24
74 0.24
75 0.21
76 0.16
77 0.14
78 0.12
79 0.12
80 0.11
81 0.1
82 0.1
83 0.1
84 0.09
85 0.11
86 0.1
87 0.09
88 0.09
89 0.08
90 0.08
91 0.08
92 0.1
93 0.08
94 0.09
95 0.09
96 0.09
97 0.09
98 0.1
99 0.09
100 0.1
101 0.1
102 0.11
103 0.12
104 0.13
105 0.12
106 0.12
107 0.13
108 0.1
109 0.1
110 0.12
111 0.12
112 0.17
113 0.17
114 0.19
115 0.24
116 0.3
117 0.32
118 0.3
119 0.3
120 0.27
121 0.26
122 0.26
123 0.21
124 0.16
125 0.14
126 0.13
127 0.13
128 0.11
129 0.11
130 0.1
131 0.09
132 0.08
133 0.1
134 0.16
135 0.22
136 0.27
137 0.32
138 0.39
139 0.49
140 0.59
141 0.68
142 0.71
143 0.75
144 0.8
145 0.84
146 0.85
147 0.83
148 0.77
149 0.72
150 0.63
151 0.56
152 0.46
153 0.39
154 0.32
155 0.27
156 0.28
157 0.3
158 0.33
159 0.35
160 0.36
161 0.34
162 0.34
163 0.41
164 0.41
165 0.39
166 0.37
167 0.37
168 0.4
169 0.45
170 0.46
171 0.46
172 0.48
173 0.52
174 0.56
175 0.63
176 0.67
177 0.63
178 0.67
179 0.64
180 0.61
181 0.59
182 0.59
183 0.58
184 0.55
185 0.55
186 0.51
187 0.53
188 0.47
189 0.43
190 0.43
191 0.34
192 0.32
193 0.37
194 0.35
195 0.28
196 0.33