Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0L235

Protein Details
Accession T0L235    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
8-27SYAKANKKGGSRKNTKQDTFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 13, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR027500  Ribosomal_S1/3_euk  
IPR001593  Ribosomal_S3Ae  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01015  Ribosomal_S3Ae  
Amino Acid Sequences MAIQPPGSYAKANKKGGSRKNTKQDTFIRKEWFDLKAPSIFSNSNCGKTMVTKTSNKQNLSTLLIGRKFALNQADLTGNQEEYSRKFIFRINEVKGKDCIGVFDGMKMTTDKIKSIIRKWHTLIEAERDIVAKDGTILRVFVNAITKKSPDSTSKRAYCKTSEEKKIRKVMFDIIDEELSNQDLNKIMKKLSEETVSKGIEKNGSMIFLYKMFMLLKLKQLKEEKKSITIKMKMVANGNKLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.71
4 0.75
5 0.74
6 0.74
7 0.8
8 0.85
9 0.79
10 0.77
11 0.78
12 0.78
13 0.75
14 0.72
15 0.69
16 0.59
17 0.61
18 0.57
19 0.51
20 0.45
21 0.41
22 0.38
23 0.34
24 0.35
25 0.32
26 0.31
27 0.29
28 0.25
29 0.31
30 0.3
31 0.3
32 0.29
33 0.29
34 0.26
35 0.28
36 0.33
37 0.31
38 0.35
39 0.38
40 0.41
41 0.51
42 0.57
43 0.54
44 0.5
45 0.47
46 0.44
47 0.42
48 0.4
49 0.33
50 0.31
51 0.31
52 0.29
53 0.26
54 0.24
55 0.2
56 0.21
57 0.2
58 0.15
59 0.15
60 0.16
61 0.17
62 0.15
63 0.18
64 0.16
65 0.13
66 0.12
67 0.13
68 0.13
69 0.13
70 0.19
71 0.17
72 0.17
73 0.18
74 0.21
75 0.23
76 0.28
77 0.33
78 0.32
79 0.37
80 0.38
81 0.39
82 0.37
83 0.35
84 0.29
85 0.22
86 0.18
87 0.13
88 0.14
89 0.11
90 0.11
91 0.11
92 0.09
93 0.1
94 0.1
95 0.09
96 0.11
97 0.11
98 0.1
99 0.13
100 0.17
101 0.2
102 0.25
103 0.32
104 0.32
105 0.36
106 0.37
107 0.39
108 0.36
109 0.34
110 0.31
111 0.28
112 0.25
113 0.21
114 0.2
115 0.15
116 0.14
117 0.12
118 0.11
119 0.05
120 0.06
121 0.06
122 0.07
123 0.07
124 0.07
125 0.07
126 0.08
127 0.08
128 0.08
129 0.14
130 0.14
131 0.15
132 0.16
133 0.17
134 0.17
135 0.19
136 0.22
137 0.23
138 0.29
139 0.35
140 0.43
141 0.49
142 0.54
143 0.55
144 0.56
145 0.51
146 0.52
147 0.55
148 0.55
149 0.58
150 0.62
151 0.66
152 0.7
153 0.76
154 0.69
155 0.62
156 0.55
157 0.52
158 0.47
159 0.41
160 0.36
161 0.29
162 0.28
163 0.25
164 0.23
165 0.16
166 0.12
167 0.11
168 0.08
169 0.07
170 0.1
171 0.12
172 0.16
173 0.17
174 0.17
175 0.19
176 0.23
177 0.25
178 0.26
179 0.31
180 0.29
181 0.32
182 0.37
183 0.36
184 0.34
185 0.32
186 0.31
187 0.27
188 0.26
189 0.24
190 0.19
191 0.19
192 0.18
193 0.17
194 0.16
195 0.14
196 0.14
197 0.11
198 0.12
199 0.11
200 0.14
201 0.17
202 0.18
203 0.26
204 0.34
205 0.35
206 0.41
207 0.5
208 0.56
209 0.59
210 0.65
211 0.61
212 0.62
213 0.67
214 0.67
215 0.68
216 0.65
217 0.62
218 0.59
219 0.59
220 0.53
221 0.56
222 0.55