Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MJY0

Protein Details
Accession T0MJY0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-28AELLPSRLRRRVKRGLSSKEVNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, cyto_mito 12.333, cyto_nucl 4.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR020934  Ribosomal_S15/S19_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS00323  RIBOSOMAL_S19  
Amino Acid Sequences MKFSQFAELLPSRLRRRVKRGLSSKEVNLIKECIASKEAVSNAHEKPEIVKTHARSAIIWPCMVGSIVGVHTGNGYLPLEIKPEMLGCLLSDFTVTREHPKHGKPGISDYAGSKFVPLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.59
4 0.67
5 0.72
6 0.75
7 0.8
8 0.81
9 0.8
10 0.77
11 0.7
12 0.68
13 0.61
14 0.52
15 0.44
16 0.37
17 0.29
18 0.27
19 0.25
20 0.19
21 0.18
22 0.16
23 0.14
24 0.16
25 0.17
26 0.15
27 0.17
28 0.19
29 0.18
30 0.2
31 0.2
32 0.17
33 0.18
34 0.22
35 0.21
36 0.21
37 0.25
38 0.24
39 0.3
40 0.32
41 0.3
42 0.24
43 0.27
44 0.29
45 0.26
46 0.23
47 0.17
48 0.15
49 0.15
50 0.14
51 0.1
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.08
67 0.08
68 0.09
69 0.08
70 0.08
71 0.09
72 0.08
73 0.08
74 0.06
75 0.07
76 0.07
77 0.07
78 0.07
79 0.06
80 0.07
81 0.12
82 0.13
83 0.2
84 0.22
85 0.27
86 0.34
87 0.38
88 0.46
89 0.47
90 0.51
91 0.46
92 0.51
93 0.53
94 0.48
95 0.45
96 0.39
97 0.37
98 0.34
99 0.31