Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0MFJ4

Protein Details
Accession T0MFJ4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-31ASAAKKGEAKEKRIPRKPHRRMTKGCQMETHydrophilic
NLS Segment(s)
PositionSequence
6-22KKGEAKEKRIPRKPHRR
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036853  Ribosomal_L14_sf  
IPR000218  Ribosomal_L14P  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00238  Ribosomal_L14  
Amino Acid Sequences MASAAKKGEAKEKRIPRKPHRRMTKGCQMETLLKCADNSGAKLLKLIGVKGYKGRLNRYPSAAPGDIIVVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.8
3 0.81
4 0.86
5 0.89
6 0.9
7 0.9
8 0.89
9 0.88
10 0.86
11 0.85
12 0.81
13 0.71
14 0.63
15 0.55
16 0.53
17 0.46
18 0.4
19 0.3
20 0.23
21 0.22
22 0.2
23 0.19
24 0.12
25 0.12
26 0.12
27 0.13
28 0.13
29 0.13
30 0.13
31 0.15
32 0.14
33 0.14
34 0.15
35 0.15
36 0.16
37 0.19
38 0.23
39 0.24
40 0.27
41 0.33
42 0.36
43 0.42
44 0.45
45 0.48
46 0.47
47 0.46
48 0.5
49 0.44
50 0.37
51 0.3