Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0LA88

Protein Details
Accession T0LA88   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
210-229DDSPCVKGTKKKNSDFNIKIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 14, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003892  CUE  
IPR036063  Smr_dom_sf  
Gene Ontology GO:0043130  F:ubiquitin binding  
PROSITE View protein in PROSITE  
PS51140  CUE  
Amino Acid Sequences MLENELNEERNFIKEMFPHLNDEIINRLFLSSKDINIVITKILDNNYDGLYLNLKDLTVNQIHQNIHKKNFFYPELFNNSFIDVKEGDKNHDYVINLYEKIKYFKNKSCICKDKRLAQFYQQEIEKLHLEIDKRNRKRVLAVLKNTLKKPEMLDLHGLYTKEALMFISDYITFFKPLEINLVTGREGHSNSLRPSVIAYLKQHNYKVVMDDSPCVKGTKKKNSDFNIKIIKSKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.31
4 0.32
5 0.34
6 0.33
7 0.34
8 0.31
9 0.3
10 0.29
11 0.22
12 0.21
13 0.16
14 0.16
15 0.15
16 0.15
17 0.21
18 0.17
19 0.17
20 0.19
21 0.19
22 0.2
23 0.2
24 0.21
25 0.14
26 0.13
27 0.13
28 0.12
29 0.14
30 0.14
31 0.13
32 0.14
33 0.13
34 0.13
35 0.12
36 0.11
37 0.12
38 0.12
39 0.12
40 0.1
41 0.1
42 0.09
43 0.1
44 0.14
45 0.13
46 0.14
47 0.16
48 0.21
49 0.22
50 0.28
51 0.37
52 0.38
53 0.42
54 0.45
55 0.43
56 0.42
57 0.48
58 0.44
59 0.38
60 0.36
61 0.35
62 0.4
63 0.4
64 0.37
65 0.31
66 0.3
67 0.28
68 0.24
69 0.21
70 0.13
71 0.13
72 0.17
73 0.17
74 0.19
75 0.19
76 0.2
77 0.18
78 0.2
79 0.18
80 0.15
81 0.17
82 0.15
83 0.15
84 0.15
85 0.16
86 0.15
87 0.17
88 0.2
89 0.23
90 0.27
91 0.32
92 0.41
93 0.45
94 0.51
95 0.58
96 0.64
97 0.63
98 0.67
99 0.65
100 0.65
101 0.66
102 0.64
103 0.56
104 0.54
105 0.56
106 0.47
107 0.47
108 0.38
109 0.31
110 0.26
111 0.27
112 0.2
113 0.14
114 0.13
115 0.12
116 0.12
117 0.17
118 0.26
119 0.35
120 0.37
121 0.44
122 0.45
123 0.44
124 0.46
125 0.49
126 0.49
127 0.48
128 0.49
129 0.52
130 0.56
131 0.6
132 0.57
133 0.53
134 0.43
135 0.35
136 0.33
137 0.31
138 0.27
139 0.24
140 0.27
141 0.25
142 0.26
143 0.27
144 0.25
145 0.18
146 0.16
147 0.14
148 0.1
149 0.09
150 0.07
151 0.06
152 0.06
153 0.06
154 0.07
155 0.07
156 0.07
157 0.1
158 0.11
159 0.11
160 0.11
161 0.12
162 0.11
163 0.12
164 0.16
165 0.14
166 0.15
167 0.16
168 0.17
169 0.16
170 0.16
171 0.17
172 0.15
173 0.15
174 0.17
175 0.2
176 0.23
177 0.24
178 0.29
179 0.27
180 0.24
181 0.25
182 0.26
183 0.26
184 0.26
185 0.29
186 0.33
187 0.38
188 0.43
189 0.43
190 0.41
191 0.41
192 0.37
193 0.37
194 0.32
195 0.3
196 0.27
197 0.29
198 0.28
199 0.28
200 0.28
201 0.25
202 0.25
203 0.3
204 0.39
205 0.46
206 0.54
207 0.6
208 0.68
209 0.75
210 0.83
211 0.79
212 0.78
213 0.77
214 0.69