Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0KZH5

Protein Details
Accession T0KZH5   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-69RLHGIKAKLFTKKRRNEKIQLKKNLKIKEBasic
NLS Segment(s)
PositionSequence
26-70KKEARSAAILGRKVKRLHGIKAKLFTKKRRNEKIQLKKNLKIKEK
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
Amino Acid Sequences MPQNNFVEQHIKKYGRQLDYEIKQLKKEARSAAILGRKVKRLHGIKAKLFTKKRRNEKIQLKKNLKIKEKIDKNISVYDNDSPLPHFLLDRELQQQGKDLNNKIKQQRQDRAAKYSVPIAEVKGVSESEVFGVVASGKNKSKHWKRMVSKPCFVGNDFTRKPPKYERFIRPMALRFKKAHVSHPELKTTFNLPIIGLKKNPHSDVFTNLGVLSKGTIIEVNVSELGIVNSQGNITWGKYAQITNHPENDGCINAVLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.53
4 0.53
5 0.54
6 0.54
7 0.61
8 0.59
9 0.52
10 0.5
11 0.52
12 0.53
13 0.47
14 0.5
15 0.46
16 0.43
17 0.44
18 0.44
19 0.45
20 0.45
21 0.45
22 0.46
23 0.46
24 0.47
25 0.46
26 0.48
27 0.5
28 0.49
29 0.54
30 0.57
31 0.61
32 0.6
33 0.67
34 0.69
35 0.69
36 0.71
37 0.72
38 0.72
39 0.74
40 0.79
41 0.81
42 0.84
43 0.85
44 0.88
45 0.89
46 0.89
47 0.9
48 0.86
49 0.82
50 0.81
51 0.79
52 0.75
53 0.72
54 0.68
55 0.68
56 0.69
57 0.7
58 0.69
59 0.64
60 0.59
61 0.58
62 0.53
63 0.44
64 0.38
65 0.33
66 0.28
67 0.24
68 0.21
69 0.15
70 0.14
71 0.13
72 0.11
73 0.1
74 0.08
75 0.12
76 0.13
77 0.14
78 0.16
79 0.18
80 0.18
81 0.18
82 0.21
83 0.19
84 0.23
85 0.25
86 0.26
87 0.32
88 0.38
89 0.44
90 0.47
91 0.51
92 0.54
93 0.58
94 0.61
95 0.6
96 0.64
97 0.61
98 0.6
99 0.56
100 0.49
101 0.41
102 0.38
103 0.31
104 0.23
105 0.2
106 0.15
107 0.15
108 0.14
109 0.13
110 0.1
111 0.09
112 0.08
113 0.08
114 0.07
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.04
121 0.06
122 0.06
123 0.09
124 0.11
125 0.13
126 0.16
127 0.26
128 0.35
129 0.43
130 0.51
131 0.59
132 0.61
133 0.7
134 0.78
135 0.75
136 0.71
137 0.64
138 0.6
139 0.51
140 0.47
141 0.42
142 0.35
143 0.37
144 0.34
145 0.37
146 0.41
147 0.4
148 0.44
149 0.48
150 0.52
151 0.51
152 0.59
153 0.61
154 0.61
155 0.63
156 0.63
157 0.58
158 0.57
159 0.59
160 0.54
161 0.51
162 0.46
163 0.46
164 0.51
165 0.48
166 0.49
167 0.47
168 0.5
169 0.54
170 0.56
171 0.59
172 0.51
173 0.5
174 0.44
175 0.38
176 0.32
177 0.25
178 0.22
179 0.15
180 0.21
181 0.23
182 0.23
183 0.23
184 0.24
185 0.29
186 0.33
187 0.35
188 0.32
189 0.35
190 0.34
191 0.36
192 0.38
193 0.32
194 0.28
195 0.25
196 0.23
197 0.18
198 0.16
199 0.11
200 0.07
201 0.07
202 0.07
203 0.08
204 0.07
205 0.09
206 0.1
207 0.11
208 0.11
209 0.1
210 0.1
211 0.1
212 0.1
213 0.08
214 0.08
215 0.07
216 0.07
217 0.07
218 0.07
219 0.08
220 0.09
221 0.09
222 0.12
223 0.12
224 0.13
225 0.16
226 0.18
227 0.21
228 0.29
229 0.36
230 0.38
231 0.43
232 0.43
233 0.41
234 0.41
235 0.39
236 0.31
237 0.25
238 0.19