Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MCY6

Protein Details
Accession T0MCY6   
Localization Confidence Medium
Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPVKRKNHGKNRKNRGSCKPIQCDKCHydrophilic
80-102HLRVVKVRSRHGRKIRYDGERKLBasic
NLS Segment(s)
PositionSequence
5-13RKNHGKNRK
Subcellular Location(s) nucl 16, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
Amino Acid Sequences MPVKRKNHGKNRKNRGSCKPIQCDKCGRLVPKDKCVKRFRIMPLIEAGSMDDVKIASIYDTFEVPRTSYKNQYCISCACHLRVVKVRSRHGRKIRYDGERKLIRTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.88
4 0.87
5 0.86
6 0.85
7 0.83
8 0.79
9 0.76
10 0.74
11 0.66
12 0.65
13 0.61
14 0.54
15 0.54
16 0.59
17 0.58
18 0.59
19 0.66
20 0.63
21 0.66
22 0.7
23 0.68
24 0.63
25 0.65
26 0.61
27 0.6
28 0.56
29 0.48
30 0.44
31 0.38
32 0.33
33 0.25
34 0.2
35 0.11
36 0.1
37 0.08
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.04
45 0.04
46 0.05
47 0.05
48 0.06
49 0.07
50 0.08
51 0.08
52 0.12
53 0.15
54 0.18
55 0.27
56 0.29
57 0.35
58 0.37
59 0.38
60 0.37
61 0.36
62 0.37
63 0.34
64 0.34
65 0.28
66 0.32
67 0.31
68 0.34
69 0.4
70 0.4
71 0.41
72 0.47
73 0.55
74 0.59
75 0.68
76 0.72
77 0.74
78 0.79
79 0.8
80 0.82
81 0.81
82 0.81
83 0.82
84 0.78
85 0.78
86 0.76