Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L8A9

Protein Details
Accession T0L8A9    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
211-233KEEEKIIKKLKHKFKNNEFFKIKBasic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR014000  PPV_DNA_helicase_E1_N  
Gene Ontology GO:0016817  F:hydrolase activity, acting on acid anhydrides  
Pfam View protein in Pfam  
PF00524  PPV_E1_N  
Amino Acid Sequences MSLKKINYSKEEASSIYLTNYRYKILKELQIEETQRKIRNKLLNIEENEIDPVFYKTKIDEQSMSELLSMEFESAKSTSINQSDNYNNHDLINEINENTCKNSIKDLKSENLINENYFVRDAERPEHTDKNNNEFESFNNVDTINNSYDYKNCITTNKLDKKFKKNKYVDLEAECSDEEDSTELCSENTSFIDDTEINDDVSSIFFAERQKEEEKIIKKLKHKFKNNEFFKIKDLEINNLDIDNNLDDESNDMDNNDFLYENDIKFEKVVYENVPEESEEKFIEEIRFVNLNFFNNIILNKKIHVNQKKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.32
3 0.28
4 0.27
5 0.24
6 0.28
7 0.28
8 0.27
9 0.28
10 0.29
11 0.34
12 0.37
13 0.42
14 0.4
15 0.44
16 0.46
17 0.51
18 0.53
19 0.49
20 0.5
21 0.49
22 0.51
23 0.52
24 0.51
25 0.52
26 0.57
27 0.59
28 0.61
29 0.63
30 0.64
31 0.63
32 0.63
33 0.55
34 0.47
35 0.43
36 0.34
37 0.25
38 0.17
39 0.16
40 0.13
41 0.13
42 0.13
43 0.13
44 0.2
45 0.24
46 0.26
47 0.26
48 0.28
49 0.33
50 0.33
51 0.31
52 0.24
53 0.21
54 0.17
55 0.16
56 0.13
57 0.08
58 0.07
59 0.07
60 0.08
61 0.08
62 0.09
63 0.08
64 0.1
65 0.14
66 0.17
67 0.19
68 0.18
69 0.23
70 0.27
71 0.29
72 0.33
73 0.31
74 0.28
75 0.26
76 0.25
77 0.21
78 0.17
79 0.18
80 0.14
81 0.11
82 0.12
83 0.13
84 0.13
85 0.15
86 0.17
87 0.15
88 0.15
89 0.23
90 0.29
91 0.31
92 0.36
93 0.37
94 0.37
95 0.39
96 0.4
97 0.33
98 0.31
99 0.29
100 0.23
101 0.22
102 0.19
103 0.17
104 0.15
105 0.14
106 0.11
107 0.12
108 0.14
109 0.15
110 0.18
111 0.21
112 0.25
113 0.31
114 0.3
115 0.37
116 0.37
117 0.41
118 0.43
119 0.39
120 0.35
121 0.3
122 0.3
123 0.29
124 0.27
125 0.2
126 0.17
127 0.17
128 0.16
129 0.16
130 0.18
131 0.11
132 0.11
133 0.12
134 0.11
135 0.12
136 0.15
137 0.16
138 0.15
139 0.15
140 0.15
141 0.16
142 0.22
143 0.31
144 0.37
145 0.43
146 0.5
147 0.56
148 0.65
149 0.73
150 0.76
151 0.76
152 0.71
153 0.73
154 0.72
155 0.72
156 0.65
157 0.58
158 0.53
159 0.43
160 0.39
161 0.3
162 0.23
163 0.17
164 0.12
165 0.09
166 0.07
167 0.06
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.07
175 0.07
176 0.08
177 0.07
178 0.07
179 0.1
180 0.1
181 0.1
182 0.12
183 0.12
184 0.11
185 0.1
186 0.1
187 0.08
188 0.08
189 0.07
190 0.05
191 0.04
192 0.06
193 0.08
194 0.12
195 0.13
196 0.17
197 0.19
198 0.2
199 0.23
200 0.29
201 0.31
202 0.36
203 0.43
204 0.45
205 0.51
206 0.59
207 0.67
208 0.7
209 0.76
210 0.78
211 0.81
212 0.86
213 0.84
214 0.85
215 0.77
216 0.69
217 0.63
218 0.56
219 0.45
220 0.4
221 0.36
222 0.31
223 0.29
224 0.29
225 0.26
226 0.22
227 0.22
228 0.16
229 0.16
230 0.11
231 0.1
232 0.08
233 0.08
234 0.07
235 0.09
236 0.11
237 0.11
238 0.1
239 0.1
240 0.1
241 0.1
242 0.11
243 0.1
244 0.08
245 0.07
246 0.13
247 0.15
248 0.15
249 0.17
250 0.17
251 0.17
252 0.17
253 0.18
254 0.15
255 0.14
256 0.17
257 0.17
258 0.21
259 0.22
260 0.24
261 0.24
262 0.22
263 0.21
264 0.19
265 0.19
266 0.14
267 0.14
268 0.13
269 0.16
270 0.16
271 0.16
272 0.16
273 0.18
274 0.2
275 0.19
276 0.24
277 0.24
278 0.25
279 0.25
280 0.25
281 0.22
282 0.21
283 0.23
284 0.21
285 0.22
286 0.21
287 0.22
288 0.28
289 0.33
290 0.41