Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0L5B5

Protein Details
Accession T0L5B5    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-43SPHEILKSFKKLRKKYHPDRKTGNRERYDBasic
NLS Segment(s)
PositionSequence
24-31KKLRKKYH
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MPDPYKTLNVSCTDSPHEILKSFKKLRKKYHPDRKTGNRERYDQIMEAYDLILKNPQKYINVNDFIKNYKNSEEEKIEICKIYKKFKGDMRKIIDNLILVEDNEYERIKNIIIKEIENGLVFLKSLRKNLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.32
4 0.3
5 0.27
6 0.31
7 0.34
8 0.39
9 0.45
10 0.48
11 0.55
12 0.61
13 0.71
14 0.77
15 0.81
16 0.82
17 0.85
18 0.88
19 0.87
20 0.88
21 0.88
22 0.88
23 0.87
24 0.86
25 0.8
26 0.76
27 0.7
28 0.65
29 0.57
30 0.46
31 0.37
32 0.28
33 0.23
34 0.19
35 0.16
36 0.13
37 0.09
38 0.09
39 0.12
40 0.12
41 0.12
42 0.14
43 0.16
44 0.16
45 0.18
46 0.23
47 0.25
48 0.29
49 0.29
50 0.29
51 0.29
52 0.29
53 0.3
54 0.26
55 0.21
56 0.18
57 0.2
58 0.2
59 0.23
60 0.24
61 0.23
62 0.24
63 0.25
64 0.23
65 0.21
66 0.2
67 0.22
68 0.23
69 0.29
70 0.31
71 0.32
72 0.37
73 0.43
74 0.54
75 0.54
76 0.6
77 0.6
78 0.62
79 0.59
80 0.55
81 0.49
82 0.39
83 0.32
84 0.25
85 0.19
86 0.12
87 0.12
88 0.11
89 0.1
90 0.12
91 0.11
92 0.09
93 0.1
94 0.11
95 0.11
96 0.14
97 0.15
98 0.21
99 0.22
100 0.23
101 0.24
102 0.26
103 0.27
104 0.23
105 0.22
106 0.15
107 0.14
108 0.13
109 0.12
110 0.18
111 0.2