Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0KY28

Protein Details
Accession T0KY28   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-36DTKNENKKRTRTNMGNYHRKVHydrophilic
69-89WFQNQRQKNKIRKPDERELTYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR017970  Homeobox_CS  
IPR001356  Homeobox_dom  
IPR000047  HTH_motif  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS00027  HOMEOBOX_1  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MKYDFNNEISSEKLEDTKNENKKRTRTNMGNYHRKVLYECFAKDQFPSTENREELSRLLGLTPRTIQIWFQNQRQKNKIRKPDERELTYVKPQLRHRKLDILSEFAFEFYIKRQHEKQNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.27
4 0.34
5 0.42
6 0.49
7 0.56
8 0.6
9 0.67
10 0.74
11 0.76
12 0.77
13 0.75
14 0.77
15 0.79
16 0.81
17 0.83
18 0.75
19 0.72
20 0.63
21 0.54
22 0.47
23 0.4
24 0.36
25 0.31
26 0.3
27 0.3
28 0.3
29 0.3
30 0.28
31 0.28
32 0.23
33 0.19
34 0.21
35 0.21
36 0.25
37 0.24
38 0.25
39 0.22
40 0.21
41 0.21
42 0.18
43 0.14
44 0.09
45 0.09
46 0.1
47 0.1
48 0.1
49 0.1
50 0.09
51 0.1
52 0.1
53 0.11
54 0.13
55 0.22
56 0.25
57 0.31
58 0.39
59 0.44
60 0.51
61 0.58
62 0.62
63 0.63
64 0.69
65 0.73
66 0.74
67 0.79
68 0.8
69 0.83
70 0.82
71 0.76
72 0.7
73 0.66
74 0.61
75 0.57
76 0.54
77 0.46
78 0.44
79 0.5
80 0.57
81 0.58
82 0.6
83 0.59
84 0.63
85 0.62
86 0.65
87 0.58
88 0.53
89 0.47
90 0.42
91 0.37
92 0.28
93 0.26
94 0.17
95 0.15
96 0.13
97 0.2
98 0.21
99 0.27
100 0.34