Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0MGA4

Protein Details
Accession T0MGA4    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-104VKNSSLYKSTKKKFSRKKKDKSEKYFKKIKMDFHydrophilic
NLS Segment(s)
PositionSequence
70-99KKVKNSSLYKSTKKKFSRKKKDKSEKYFKK
Subcellular Location(s) nucl 18, cyto_nucl 11.333, mito 6.5, cyto_mito 5.166
Family & Domain DBs
Amino Acid Sequences MFSLLSIFLEVINCVNHNIESNLLGSNFFNPEINEKKQKYIPKARFRDFVKYKANKIKNNVNNNFDKINKKVKNSSLYKSTKKKFSRKKKDKSEKYFKKIKMDFRYVVRLLQMSKMNVNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.12
5 0.13
6 0.13
7 0.12
8 0.13
9 0.13
10 0.12
11 0.12
12 0.11
13 0.12
14 0.12
15 0.11
16 0.12
17 0.11
18 0.17
19 0.22
20 0.27
21 0.34
22 0.34
23 0.38
24 0.43
25 0.49
26 0.53
27 0.58
28 0.62
29 0.64
30 0.71
31 0.7
32 0.72
33 0.68
34 0.69
35 0.63
36 0.6
37 0.6
38 0.55
39 0.58
40 0.6
41 0.65
42 0.58
43 0.6
44 0.62
45 0.6
46 0.66
47 0.64
48 0.59
49 0.54
50 0.52
51 0.49
52 0.42
53 0.37
54 0.31
55 0.37
56 0.36
57 0.38
58 0.41
59 0.45
60 0.51
61 0.52
62 0.53
63 0.52
64 0.55
65 0.6
66 0.64
67 0.64
68 0.65
69 0.69
70 0.75
71 0.76
72 0.81
73 0.84
74 0.85
75 0.9
76 0.92
77 0.94
78 0.95
79 0.95
80 0.95
81 0.94
82 0.91
83 0.9
84 0.84
85 0.83
86 0.79
87 0.78
88 0.76
89 0.73
90 0.7
91 0.66
92 0.69
93 0.59
94 0.54
95 0.47
96 0.4
97 0.33
98 0.35
99 0.34
100 0.29