Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MD12

Protein Details
Accession T0MD12   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
132-153STNWKDVKDKKVEYKETKKELKHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 13.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008978  HSP20-like_chaperone  
IPR007699  SGS_dom  
IPR044563  Sgt1-like  
Gene Ontology GO:0051087  F:protein-folding chaperone binding  
Pfam View protein in Pfam  
PF05002  SGS  
PROSITE View protein in PROSITE  
PS51048  SGS  
Amino Acid Sequences MIEFAESKTKVFLFFYNENITNIELVNEKLLKVDSNHIDLFKEIINIENIIKTKYKTEIVLIKKYPTKWYTLNGPKQSYNKIKFLKHKDDDDVENQECDVLDVLSRIYQNSDDDTRRAMEKSFVESGGKVLSTNWKDVKDKKVEYKETKKELK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.33
4 0.34
5 0.33
6 0.32
7 0.3
8 0.23
9 0.2
10 0.17
11 0.11
12 0.11
13 0.13
14 0.12
15 0.12
16 0.12
17 0.13
18 0.13
19 0.14
20 0.2
21 0.19
22 0.23
23 0.25
24 0.24
25 0.24
26 0.23
27 0.22
28 0.16
29 0.14
30 0.1
31 0.1
32 0.1
33 0.11
34 0.11
35 0.12
36 0.12
37 0.13
38 0.14
39 0.14
40 0.15
41 0.17
42 0.19
43 0.17
44 0.2
45 0.26
46 0.3
47 0.36
48 0.35
49 0.35
50 0.37
51 0.38
52 0.4
53 0.33
54 0.32
55 0.27
56 0.29
57 0.35
58 0.4
59 0.47
60 0.46
61 0.47
62 0.47
63 0.47
64 0.51
65 0.5
66 0.45
67 0.45
68 0.45
69 0.48
70 0.53
71 0.59
72 0.62
73 0.57
74 0.57
75 0.52
76 0.51
77 0.48
78 0.43
79 0.4
80 0.31
81 0.27
82 0.24
83 0.2
84 0.17
85 0.14
86 0.11
87 0.05
88 0.04
89 0.05
90 0.05
91 0.07
92 0.07
93 0.07
94 0.08
95 0.09
96 0.1
97 0.14
98 0.18
99 0.19
100 0.19
101 0.21
102 0.22
103 0.22
104 0.22
105 0.19
106 0.19
107 0.19
108 0.24
109 0.24
110 0.24
111 0.23
112 0.22
113 0.23
114 0.19
115 0.17
116 0.12
117 0.11
118 0.2
119 0.21
120 0.27
121 0.3
122 0.33
123 0.39
124 0.45
125 0.53
126 0.53
127 0.58
128 0.62
129 0.68
130 0.74
131 0.78
132 0.83
133 0.84