Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0M993

Protein Details
Accession T0M993    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-28KDTTNIKKGKNHKIEKNEKKELLBasic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 8, cyto 6.5, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR031492  DUF5101  
Pfam View protein in Pfam  
PF17031  DUF5101  
Amino Acid Sequences MRDILKDTTNIKKGKNHKIEKNEKKELLEHIKNVYHTTKDYSFKYDLSKCIEIIEGKENQEVIELKNALEELIKENERLLDENTILYMEKTNKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.69
4 0.7
5 0.78
6 0.85
7 0.88
8 0.88
9 0.86
10 0.78
11 0.71
12 0.65
13 0.62
14 0.6
15 0.53
16 0.46
17 0.41
18 0.4
19 0.38
20 0.38
21 0.32
22 0.24
23 0.21
24 0.24
25 0.24
26 0.26
27 0.26
28 0.28
29 0.28
30 0.27
31 0.31
32 0.29
33 0.27
34 0.29
35 0.28
36 0.24
37 0.23
38 0.23
39 0.18
40 0.17
41 0.18
42 0.15
43 0.15
44 0.16
45 0.15
46 0.13
47 0.15
48 0.14
49 0.11
50 0.15
51 0.14
52 0.13
53 0.14
54 0.14
55 0.12
56 0.12
57 0.11
58 0.1
59 0.15
60 0.16
61 0.15
62 0.16
63 0.18
64 0.19
65 0.2
66 0.18
67 0.16
68 0.16
69 0.16
70 0.16
71 0.15
72 0.14
73 0.13
74 0.15
75 0.17