Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L9K7

Protein Details
Accession T0L9K7   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
131-168LPNLYQDKSLNKKKHQKIWKKYKEKFNSTKKTQKDIKKHydrophilic
NLS Segment(s)
PositionSequence
142-168KKKHQKIWKKYKEKFNSTKKTQKDIKK
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSTSSDLKDKLINKDKIISLYDENTEIYDYTINNEKNNSNEVNTTIDNNEPIYEEIVADNYGYGLNLISKNNNISNSKSDINNNDGYEIPINFNMENNYSNTSNNNYYEDINKNKLFNNIDTTYETELDSLPNLYQDKSLNKKKHQKIWKKYKEKFNSTKKTQKDIKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.5
4 0.48
5 0.41
6 0.34
7 0.32
8 0.31
9 0.26
10 0.23
11 0.2
12 0.19
13 0.15
14 0.12
15 0.11
16 0.1
17 0.12
18 0.19
19 0.2
20 0.2
21 0.23
22 0.24
23 0.25
24 0.29
25 0.27
26 0.21
27 0.22
28 0.22
29 0.23
30 0.22
31 0.21
32 0.18
33 0.17
34 0.16
35 0.15
36 0.14
37 0.11
38 0.11
39 0.1
40 0.09
41 0.08
42 0.08
43 0.08
44 0.08
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.04
51 0.03
52 0.05
53 0.07
54 0.08
55 0.08
56 0.09
57 0.12
58 0.14
59 0.17
60 0.17
61 0.18
62 0.2
63 0.23
64 0.24
65 0.23
66 0.24
67 0.23
68 0.25
69 0.25
70 0.22
71 0.19
72 0.18
73 0.17
74 0.16
75 0.14
76 0.11
77 0.09
78 0.1
79 0.08
80 0.09
81 0.09
82 0.09
83 0.1
84 0.11
85 0.13
86 0.13
87 0.13
88 0.14
89 0.17
90 0.18
91 0.18
92 0.2
93 0.18
94 0.18
95 0.22
96 0.25
97 0.26
98 0.29
99 0.3
100 0.29
101 0.29
102 0.34
103 0.33
104 0.3
105 0.33
106 0.29
107 0.29
108 0.29
109 0.3
110 0.27
111 0.24
112 0.22
113 0.16
114 0.15
115 0.13
116 0.12
117 0.1
118 0.08
119 0.1
120 0.11
121 0.11
122 0.13
123 0.17
124 0.24
125 0.33
126 0.43
127 0.48
128 0.57
129 0.67
130 0.74
131 0.8
132 0.83
133 0.85
134 0.87
135 0.9
136 0.91
137 0.91
138 0.91
139 0.92
140 0.92
141 0.92
142 0.91
143 0.9
144 0.9
145 0.88
146 0.89
147 0.85
148 0.84