Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L2B1

Protein Details
Accession T0L2B1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MTGKTYNRRKHNENFESKGRQINKKRGTVKSKINNQVIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000692  Fibrillarin  
IPR020813  Fibrillarin_CS  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0003723  F:RNA binding  
GO:0032259  P:methylation  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01269  Fibrillarin  
PROSITE View protein in PROSITE  
PS00566  FIBRILLARIN  
Amino Acid Sequences MTGKTYNRRKHNENFESKGRQINKKRGTVKSKINNQVIVQEHKKFKNVYICRSKDDMLLTKNMVPGISVYNEKRISVCLDDNQKIEYRIWNVYRSKLAAGIVCGLENIHIHPGSKVLYLGASSGTTVSHVSDIVGETGLVYAVEFSQRSGRDLINLAMKRRNIVPIIEDARHPYKYRMIVGAVDTVFADVSQPDQSRIVIINCEYFLKDNGGVVMSIKANCINSALPAETVFADEVNILKKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.78
4 0.72
5 0.71
6 0.67
7 0.67
8 0.67
9 0.71
10 0.71
11 0.73
12 0.79
13 0.8
14 0.81
15 0.79
16 0.8
17 0.79
18 0.81
19 0.81
20 0.77
21 0.72
22 0.64
23 0.63
24 0.57
25 0.55
26 0.5
27 0.48
28 0.5
29 0.48
30 0.53
31 0.47
32 0.47
33 0.5
34 0.51
35 0.53
36 0.57
37 0.58
38 0.58
39 0.6
40 0.56
41 0.48
42 0.47
43 0.43
44 0.35
45 0.35
46 0.31
47 0.3
48 0.3
49 0.27
50 0.22
51 0.16
52 0.14
53 0.13
54 0.13
55 0.15
56 0.15
57 0.21
58 0.22
59 0.22
60 0.21
61 0.21
62 0.21
63 0.21
64 0.22
65 0.2
66 0.27
67 0.29
68 0.29
69 0.29
70 0.28
71 0.26
72 0.25
73 0.23
74 0.2
75 0.23
76 0.24
77 0.29
78 0.29
79 0.3
80 0.31
81 0.29
82 0.26
83 0.22
84 0.21
85 0.15
86 0.14
87 0.13
88 0.11
89 0.1
90 0.09
91 0.07
92 0.07
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.07
99 0.08
100 0.09
101 0.09
102 0.08
103 0.06
104 0.06
105 0.06
106 0.06
107 0.05
108 0.04
109 0.04
110 0.04
111 0.04
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.04
123 0.04
124 0.04
125 0.04
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.04
132 0.05
133 0.09
134 0.1
135 0.12
136 0.14
137 0.13
138 0.14
139 0.16
140 0.17
141 0.21
142 0.23
143 0.23
144 0.26
145 0.26
146 0.26
147 0.26
148 0.28
149 0.21
150 0.2
151 0.19
152 0.22
153 0.25
154 0.25
155 0.24
156 0.25
157 0.28
158 0.29
159 0.29
160 0.24
161 0.26
162 0.29
163 0.31
164 0.28
165 0.26
166 0.25
167 0.25
168 0.27
169 0.21
170 0.17
171 0.15
172 0.13
173 0.11
174 0.09
175 0.08
176 0.04
177 0.06
178 0.1
179 0.11
180 0.12
181 0.14
182 0.14
183 0.15
184 0.17
185 0.17
186 0.15
187 0.16
188 0.16
189 0.16
190 0.17
191 0.17
192 0.16
193 0.16
194 0.17
195 0.16
196 0.15
197 0.15
198 0.14
199 0.13
200 0.12
201 0.14
202 0.13
203 0.13
204 0.13
205 0.15
206 0.15
207 0.15
208 0.16
209 0.14
210 0.14
211 0.17
212 0.17
213 0.15
214 0.14
215 0.15
216 0.14
217 0.15
218 0.13
219 0.1
220 0.09
221 0.09
222 0.1
223 0.12