Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0LCA5

Protein Details
Accession T0LCA5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
28-52NVIPQKHMRLHKRKYKEIKNLPFIQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MQIILFFLYVFCKHNKNEEILLNTKEYNVIPQKHMRLHKRKYKEIKNLPFIQLTEEVKLENSNKRPFVFKRIFVHNNDLKSFMKKELKHIFPFLYENIDRKFNNRNIDLEKFRDLIFMKKRQFIRDNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.36
4 0.4
5 0.42
6 0.45
7 0.44
8 0.44
9 0.38
10 0.34
11 0.3
12 0.26
13 0.21
14 0.23
15 0.26
16 0.27
17 0.29
18 0.35
19 0.4
20 0.45
21 0.54
22 0.57
23 0.6
24 0.66
25 0.71
26 0.74
27 0.79
28 0.82
29 0.84
30 0.84
31 0.85
32 0.84
33 0.83
34 0.78
35 0.71
36 0.62
37 0.52
38 0.44
39 0.37
40 0.29
41 0.22
42 0.18
43 0.15
44 0.14
45 0.15
46 0.15
47 0.16
48 0.21
49 0.23
50 0.25
51 0.26
52 0.31
53 0.3
54 0.37
55 0.36
56 0.37
57 0.38
58 0.44
59 0.48
60 0.46
61 0.52
62 0.47
63 0.45
64 0.39
65 0.38
66 0.31
67 0.3
68 0.29
69 0.27
70 0.32
71 0.3
72 0.38
73 0.44
74 0.49
75 0.49
76 0.5
77 0.44
78 0.38
79 0.4
80 0.31
81 0.29
82 0.24
83 0.25
84 0.24
85 0.29
86 0.27
87 0.28
88 0.36
89 0.35
90 0.41
91 0.4
92 0.43
93 0.44
94 0.51
95 0.53
96 0.48
97 0.47
98 0.4
99 0.38
100 0.37
101 0.32
102 0.34
103 0.38
104 0.43
105 0.44
106 0.51
107 0.55
108 0.59
109 0.66