Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L7I7

Protein Details
Accession T0L7I7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MKPKNDEEKQEKKKKLNLNFIKEKNKNRRLFENKNFNTKEHydrophilic
NLS Segment(s)
PositionSequence
12-15KKKK
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
IPR002554  PP2A_B56  
Gene Ontology GO:0000159  C:protein phosphatase type 2A complex  
GO:0019888  F:protein phosphatase regulator activity  
GO:0007165  P:signal transduction  
Pfam View protein in Pfam  
PF01603  B56  
Amino Acid Sequences MKPKNDEEKQEKKKKLNLNFIKEKNKNRRLFENKNFNTKENNTIDNIFNLNINEPNFKVVNKYKSNSEVHINSFLIENIHSKDTLTLYELLCQLKKTKITENLFIIIVNKCKDVLFREIKNSNPTGVQFHVGDDVNVKNSVSSNINIFAKILNYVTSVMYDNNIILKVFCDSDILNLINLLKSEDENERAQIANVLLNIFKNFKITIRNVIENELCLFYEGLRTHIGMEELLEVVSCIIEDMVRIKPIKREYVKLENKKFPISNDQSIISNNNFKDKNEEKLKEKNNSFFYEYVLRFLTVNNLEYYTNINQIIFSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.83
5 0.83
6 0.84
7 0.85
8 0.87
9 0.86
10 0.86
11 0.86
12 0.86
13 0.84
14 0.8
15 0.82
16 0.81
17 0.84
18 0.84
19 0.84
20 0.79
21 0.82
22 0.79
23 0.7
24 0.68
25 0.6
26 0.59
27 0.52
28 0.5
29 0.42
30 0.42
31 0.41
32 0.35
33 0.33
34 0.24
35 0.21
36 0.19
37 0.18
38 0.18
39 0.19
40 0.19
41 0.18
42 0.21
43 0.2
44 0.2
45 0.25
46 0.29
47 0.37
48 0.4
49 0.43
50 0.44
51 0.5
52 0.53
53 0.48
54 0.48
55 0.43
56 0.4
57 0.42
58 0.37
59 0.3
60 0.27
61 0.25
62 0.18
63 0.15
64 0.14
65 0.12
66 0.13
67 0.13
68 0.12
69 0.14
70 0.14
71 0.14
72 0.14
73 0.14
74 0.13
75 0.17
76 0.19
77 0.19
78 0.19
79 0.19
80 0.2
81 0.21
82 0.25
83 0.25
84 0.3
85 0.38
86 0.41
87 0.45
88 0.45
89 0.42
90 0.38
91 0.35
92 0.3
93 0.22
94 0.22
95 0.17
96 0.15
97 0.13
98 0.13
99 0.15
100 0.16
101 0.23
102 0.26
103 0.27
104 0.34
105 0.36
106 0.39
107 0.42
108 0.39
109 0.32
110 0.26
111 0.25
112 0.21
113 0.2
114 0.19
115 0.14
116 0.14
117 0.16
118 0.14
119 0.13
120 0.12
121 0.11
122 0.11
123 0.11
124 0.1
125 0.08
126 0.08
127 0.1
128 0.1
129 0.1
130 0.1
131 0.13
132 0.13
133 0.13
134 0.13
135 0.11
136 0.09
137 0.1
138 0.09
139 0.06
140 0.06
141 0.07
142 0.07
143 0.08
144 0.08
145 0.07
146 0.08
147 0.07
148 0.06
149 0.06
150 0.07
151 0.06
152 0.05
153 0.05
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.07
160 0.09
161 0.09
162 0.08
163 0.08
164 0.08
165 0.08
166 0.08
167 0.07
168 0.05
169 0.05
170 0.08
171 0.09
172 0.12
173 0.12
174 0.13
175 0.14
176 0.13
177 0.13
178 0.13
179 0.11
180 0.09
181 0.09
182 0.09
183 0.08
184 0.08
185 0.1
186 0.09
187 0.09
188 0.1
189 0.1
190 0.11
191 0.17
192 0.18
193 0.26
194 0.29
195 0.33
196 0.32
197 0.35
198 0.33
199 0.28
200 0.28
201 0.19
202 0.15
203 0.12
204 0.11
205 0.08
206 0.13
207 0.12
208 0.13
209 0.13
210 0.13
211 0.13
212 0.14
213 0.14
214 0.09
215 0.09
216 0.08
217 0.07
218 0.07
219 0.06
220 0.05
221 0.05
222 0.04
223 0.04
224 0.03
225 0.03
226 0.03
227 0.03
228 0.06
229 0.08
230 0.12
231 0.13
232 0.15
233 0.22
234 0.27
235 0.36
236 0.38
237 0.42
238 0.46
239 0.56
240 0.65
241 0.69
242 0.73
243 0.72
244 0.71
245 0.71
246 0.65
247 0.58
248 0.59
249 0.56
250 0.53
251 0.47
252 0.45
253 0.4
254 0.4
255 0.4
256 0.33
257 0.32
258 0.27
259 0.32
260 0.32
261 0.31
262 0.39
263 0.38
264 0.45
265 0.48
266 0.53
267 0.51
268 0.6
269 0.68
270 0.69
271 0.72
272 0.7
273 0.66
274 0.65
275 0.64
276 0.54
277 0.5
278 0.49
279 0.43
280 0.38
281 0.33
282 0.29
283 0.25
284 0.24
285 0.28
286 0.22
287 0.24
288 0.22
289 0.22
290 0.22
291 0.22
292 0.28
293 0.22
294 0.23
295 0.22
296 0.2