Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0MFM8

Protein Details
Accession T0MFM8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
201-235VEEYCNKIPKKNSNKDNKKKSEKLTKRTNENEENVHydrophilic
NLS Segment(s)
PositionSequence
210-227KKNSNKDNKKKSEKLTKR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, cyto 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR006630  La_HTH  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
PROSITE View protein in PROSITE  
PS50961  HTH_LA  
Amino Acid Sequences MTLNKIKNKLIDTFLKQQALINNGYIPIKTILTFKKMRELEATEEKVIDSIKNSNVVELKDGCLKKIETDEFKSYICESDIDSRCLYISGFDKNMNFEELENILKSYMTPLLIRMRLENEEKKVKEAKEALKSDFLNKLFKYEINKEVSDIAVIKNLVSDVAFVDLNEKVIRLKFSKDFENKEYEKDDMKINITKLNKKEVEEYCNKIPKKNSNKDNKKKSEKLTKRTNENEENVKKIKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.48
4 0.47
5 0.45
6 0.4
7 0.35
8 0.27
9 0.22
10 0.22
11 0.23
12 0.19
13 0.17
14 0.15
15 0.14
16 0.14
17 0.19
18 0.21
19 0.27
20 0.32
21 0.3
22 0.38
23 0.38
24 0.4
25 0.4
26 0.4
27 0.4
28 0.45
29 0.47
30 0.38
31 0.37
32 0.35
33 0.3
34 0.27
35 0.2
36 0.13
37 0.13
38 0.14
39 0.2
40 0.2
41 0.21
42 0.23
43 0.23
44 0.25
45 0.22
46 0.22
47 0.25
48 0.25
49 0.23
50 0.23
51 0.23
52 0.22
53 0.27
54 0.3
55 0.28
56 0.33
57 0.37
58 0.35
59 0.35
60 0.34
61 0.28
62 0.24
63 0.19
64 0.14
65 0.12
66 0.21
67 0.23
68 0.24
69 0.23
70 0.22
71 0.21
72 0.21
73 0.19
74 0.11
75 0.11
76 0.12
77 0.13
78 0.15
79 0.15
80 0.17
81 0.18
82 0.16
83 0.14
84 0.11
85 0.12
86 0.11
87 0.12
88 0.1
89 0.09
90 0.08
91 0.08
92 0.08
93 0.07
94 0.07
95 0.07
96 0.07
97 0.09
98 0.13
99 0.15
100 0.15
101 0.15
102 0.16
103 0.18
104 0.22
105 0.23
106 0.23
107 0.28
108 0.28
109 0.31
110 0.34
111 0.31
112 0.32
113 0.34
114 0.36
115 0.38
116 0.4
117 0.38
118 0.38
119 0.38
120 0.36
121 0.36
122 0.31
123 0.27
124 0.25
125 0.25
126 0.21
127 0.23
128 0.26
129 0.26
130 0.3
131 0.3
132 0.3
133 0.28
134 0.28
135 0.26
136 0.21
137 0.17
138 0.11
139 0.1
140 0.1
141 0.09
142 0.08
143 0.08
144 0.07
145 0.06
146 0.06
147 0.04
148 0.06
149 0.06
150 0.06
151 0.08
152 0.08
153 0.09
154 0.09
155 0.09
156 0.08
157 0.1
158 0.14
159 0.14
160 0.18
161 0.22
162 0.26
163 0.35
164 0.4
165 0.44
166 0.44
167 0.51
168 0.48
169 0.46
170 0.46
171 0.39
172 0.35
173 0.31
174 0.31
175 0.25
176 0.28
177 0.29
178 0.27
179 0.31
180 0.34
181 0.4
182 0.39
183 0.46
184 0.45
185 0.43
186 0.5
187 0.49
188 0.52
189 0.51
190 0.55
191 0.54
192 0.59
193 0.58
194 0.55
195 0.58
196 0.6
197 0.65
198 0.69
199 0.7
200 0.73
201 0.84
202 0.89
203 0.92
204 0.93
205 0.92
206 0.9
207 0.9
208 0.9
209 0.89
210 0.88
211 0.88
212 0.87
213 0.86
214 0.87
215 0.86
216 0.83
217 0.79
218 0.8
219 0.74
220 0.72