Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0MF08

Protein Details
Accession T0MF08    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-50FPSSTKPRPEPKPKPEPNHKPRHNSKLNTHydrophilic
NLS Segment(s)
PositionSequence
25-44STKPRPEPKPKPEPNHKPRH
Subcellular Location(s) mito 16.5, mito_nucl 13.166, nucl 8.5, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MNFINNLILGKNTPKKSQKSTFPSSTKPRPEPKPKPEPNHKPRHNSKLNTGSDEQYWLNILINPKLDLTNTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.59
4 0.65
5 0.67
6 0.67
7 0.71
8 0.72
9 0.68
10 0.7
11 0.69
12 0.7
13 0.68
14 0.67
15 0.67
16 0.67
17 0.74
18 0.76
19 0.77
20 0.79
21 0.79
22 0.81
23 0.83
24 0.85
25 0.84
26 0.85
27 0.82
28 0.81
29 0.81
30 0.82
31 0.81
32 0.73
33 0.71
34 0.7
35 0.66
36 0.62
37 0.56
38 0.47
39 0.39
40 0.38
41 0.3
42 0.2
43 0.19
44 0.15
45 0.13
46 0.14
47 0.16
48 0.16
49 0.18
50 0.18
51 0.18
52 0.18