Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0LBR5

Protein Details
Accession T0LBR5   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
189-216ICDKVNKHRNYIKECRNKNKKAEKMILIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11.833, cyto 6.5, cyto_mito 4.166, pero 3
Family & Domain DBs
Amino Acid Sequences MSEKINIDFLFKNISKISPNTLSSLDVSEEFNALKLELNNKDLNKLKVIFTIEILIKIIKKKQDERILIDILLYILQKYNSCTFIIFRLRIIKNILSLNCYVPCFLILFNIFEQIDSFKEYSEGSMNYDSLNVKDQIDSLFVLQELRSLFLSNLNKISDCYGFVEVSNILLKEFKKHNKEIYSEFIEGICDKVNKHRNYIKECRNKNKKAEKMILI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.28
3 0.29
4 0.35
5 0.33
6 0.34
7 0.33
8 0.33
9 0.32
10 0.29
11 0.28
12 0.23
13 0.17
14 0.17
15 0.15
16 0.15
17 0.13
18 0.12
19 0.11
20 0.1
21 0.11
22 0.12
23 0.17
24 0.19
25 0.23
26 0.27
27 0.27
28 0.34
29 0.37
30 0.37
31 0.36
32 0.35
33 0.32
34 0.31
35 0.34
36 0.28
37 0.24
38 0.25
39 0.21
40 0.19
41 0.19
42 0.16
43 0.14
44 0.17
45 0.2
46 0.22
47 0.27
48 0.33
49 0.41
50 0.5
51 0.52
52 0.55
53 0.56
54 0.53
55 0.47
56 0.4
57 0.31
58 0.21
59 0.18
60 0.12
61 0.06
62 0.06
63 0.07
64 0.07
65 0.1
66 0.12
67 0.13
68 0.13
69 0.13
70 0.13
71 0.18
72 0.23
73 0.21
74 0.2
75 0.27
76 0.27
77 0.29
78 0.31
79 0.26
80 0.24
81 0.27
82 0.25
83 0.19
84 0.2
85 0.19
86 0.18
87 0.17
88 0.14
89 0.11
90 0.11
91 0.09
92 0.08
93 0.08
94 0.07
95 0.08
96 0.08
97 0.1
98 0.09
99 0.09
100 0.09
101 0.08
102 0.08
103 0.09
104 0.09
105 0.07
106 0.08
107 0.08
108 0.09
109 0.1
110 0.1
111 0.1
112 0.11
113 0.11
114 0.1
115 0.12
116 0.11
117 0.1
118 0.12
119 0.11
120 0.1
121 0.11
122 0.11
123 0.1
124 0.11
125 0.11
126 0.08
127 0.08
128 0.07
129 0.08
130 0.07
131 0.09
132 0.08
133 0.09
134 0.09
135 0.09
136 0.09
137 0.16
138 0.19
139 0.18
140 0.21
141 0.2
142 0.2
143 0.2
144 0.22
145 0.16
146 0.15
147 0.16
148 0.15
149 0.14
150 0.14
151 0.15
152 0.13
153 0.13
154 0.14
155 0.11
156 0.09
157 0.12
158 0.13
159 0.17
160 0.26
161 0.33
162 0.39
163 0.44
164 0.52
165 0.55
166 0.6
167 0.58
168 0.57
169 0.55
170 0.48
171 0.43
172 0.35
173 0.31
174 0.26
175 0.23
176 0.19
177 0.14
178 0.14
179 0.24
180 0.33
181 0.34
182 0.43
183 0.48
184 0.53
185 0.61
186 0.71
187 0.72
188 0.73
189 0.8
190 0.83
191 0.87
192 0.87
193 0.89
194 0.89
195 0.88
196 0.87