Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L9S1

Protein Details
Accession T0L9S1    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MQRKFNSKSRHNNKNKYDTSGSHydrophilic
106-136VEKKKEANDKKHKNIKKEKFKQENKYKFQNDBasic
NLS Segment(s)
PositionSequence
108-132KKKEANDKKHKNIKKEKFKQENKYK
139-158DKKRKFVRNGKFGGDKNKKK
Subcellular Location(s) mito 14, nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR038664  Gar1/Naf1_Cbf5-bd_sf  
IPR007504  H/ACA_rnp_Gar1/Naf1  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0001522  P:pseudouridine synthesis  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF04410  Gar1  
Amino Acid Sequences MQRKFNSKSRHNNKNKYDTSGSLIDLGTFMHKCGNFYIIKLSDIDIPYPNAFIYNKNKQQIGKVEEIFGRQNDVHVAVKIEKDSNEFFIYSNKLIPRNRFLERSDVEKKKEANDKKHKNIKKEKFKQENKYKFQNDSYDKKRKFVRNGKFGGDKNKKKNFGNIKVLLDLIQIQDNLQQVECLEKEDINTYAISLTKLGNRLAIYRVNHFATPSKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.84
3 0.81
4 0.75
5 0.67
6 0.61
7 0.53
8 0.44
9 0.35
10 0.31
11 0.23
12 0.18
13 0.16
14 0.14
15 0.12
16 0.11
17 0.14
18 0.15
19 0.16
20 0.17
21 0.21
22 0.18
23 0.19
24 0.26
25 0.22
26 0.22
27 0.22
28 0.22
29 0.22
30 0.22
31 0.23
32 0.17
33 0.19
34 0.18
35 0.18
36 0.17
37 0.14
38 0.14
39 0.18
40 0.25
41 0.32
42 0.38
43 0.41
44 0.44
45 0.43
46 0.49
47 0.51
48 0.48
49 0.45
50 0.39
51 0.38
52 0.36
53 0.37
54 0.33
55 0.25
56 0.23
57 0.16
58 0.16
59 0.14
60 0.16
61 0.14
62 0.13
63 0.14
64 0.13
65 0.14
66 0.14
67 0.15
68 0.13
69 0.14
70 0.15
71 0.16
72 0.16
73 0.15
74 0.14
75 0.15
76 0.17
77 0.15
78 0.17
79 0.16
80 0.21
81 0.24
82 0.27
83 0.3
84 0.32
85 0.34
86 0.34
87 0.33
88 0.35
89 0.33
90 0.38
91 0.41
92 0.4
93 0.4
94 0.41
95 0.4
96 0.38
97 0.46
98 0.46
99 0.48
100 0.55
101 0.62
102 0.68
103 0.77
104 0.76
105 0.77
106 0.81
107 0.8
108 0.81
109 0.82
110 0.83
111 0.84
112 0.89
113 0.89
114 0.89
115 0.89
116 0.84
117 0.84
118 0.76
119 0.69
120 0.64
121 0.62
122 0.58
123 0.56
124 0.59
125 0.6
126 0.57
127 0.58
128 0.63
129 0.62
130 0.66
131 0.67
132 0.68
133 0.67
134 0.7
135 0.71
136 0.69
137 0.64
138 0.65
139 0.65
140 0.64
141 0.65
142 0.69
143 0.7
144 0.65
145 0.72
146 0.72
147 0.7
148 0.71
149 0.66
150 0.6
151 0.55
152 0.53
153 0.44
154 0.33
155 0.25
156 0.17
157 0.13
158 0.11
159 0.1
160 0.12
161 0.14
162 0.14
163 0.13
164 0.12
165 0.1
166 0.14
167 0.14
168 0.14
169 0.14
170 0.13
171 0.14
172 0.17
173 0.18
174 0.15
175 0.15
176 0.12
177 0.12
178 0.13
179 0.12
180 0.11
181 0.12
182 0.15
183 0.18
184 0.18
185 0.2
186 0.2
187 0.22
188 0.24
189 0.29
190 0.28
191 0.3
192 0.35
193 0.35
194 0.34
195 0.34