Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0LCY9

Protein Details
Accession T0LCY9   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
322-342KNWKLLVKMCNRYKKLQSKFCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, cyto 7, mito 5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004583  DNA_repair_Rad4  
IPR018326  Rad4_beta-hairpin_dom1  
IPR018328  Rad4_beta-hairpin_dom3  
IPR042488  Rad4_BHD3_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003684  F:damaged DNA binding  
GO:0006289  P:nucleotide-excision repair  
Pfam View protein in Pfam  
PF10403  BHD_1  
PF10405  BHD_3  
Amino Acid Sequences MIKEPINIPIIDEFIDINVLNKLEELCKTKDQIESNIKFFKCLTHYNIYSRLYITFKSSFLEITVNDIIIKHSNKYIGPVFYIDSLYNIEDYSWYFSKDMKNYKIFFDVFKLFKKYISNIIFNNYNTNTIFENNISINKKLDNLRIKQIPTNTNKFIHHPLFCLESLLNNKQKLSKRNIQGYFKGEPVFLKSDIKSYKSLKYYYKNGFEPIDKSDTSDLYSQDQVKPIVISDMNDKLIQDYLHPSHVPKNCIYINNEYVEHVCKKLKINYRLCFVGFNKMNPIYRGVFIYKKDLFLVSNFLFEMFDYNKKLEIIQKYNKINKNWKLLVKMCNRYKKLQSKFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.11
4 0.1
5 0.11
6 0.11
7 0.1
8 0.11
9 0.12
10 0.13
11 0.17
12 0.22
13 0.25
14 0.29
15 0.32
16 0.35
17 0.39
18 0.41
19 0.46
20 0.51
21 0.5
22 0.52
23 0.57
24 0.53
25 0.48
26 0.45
27 0.41
28 0.35
29 0.37
30 0.38
31 0.39
32 0.43
33 0.46
34 0.53
35 0.49
36 0.46
37 0.41
38 0.37
39 0.31
40 0.28
41 0.29
42 0.24
43 0.22
44 0.22
45 0.22
46 0.19
47 0.17
48 0.19
49 0.13
50 0.17
51 0.17
52 0.16
53 0.15
54 0.15
55 0.16
56 0.19
57 0.2
58 0.16
59 0.18
60 0.2
61 0.2
62 0.25
63 0.27
64 0.23
65 0.23
66 0.23
67 0.21
68 0.2
69 0.21
70 0.16
71 0.13
72 0.13
73 0.12
74 0.11
75 0.1
76 0.09
77 0.08
78 0.09
79 0.13
80 0.12
81 0.13
82 0.14
83 0.17
84 0.23
85 0.29
86 0.36
87 0.37
88 0.43
89 0.43
90 0.45
91 0.47
92 0.42
93 0.37
94 0.34
95 0.32
96 0.28
97 0.31
98 0.33
99 0.28
100 0.3
101 0.31
102 0.29
103 0.33
104 0.34
105 0.34
106 0.3
107 0.34
108 0.35
109 0.32
110 0.35
111 0.26
112 0.24
113 0.21
114 0.21
115 0.18
116 0.16
117 0.17
118 0.12
119 0.13
120 0.12
121 0.17
122 0.17
123 0.17
124 0.17
125 0.16
126 0.2
127 0.21
128 0.28
129 0.3
130 0.31
131 0.37
132 0.41
133 0.41
134 0.41
135 0.43
136 0.44
137 0.42
138 0.45
139 0.42
140 0.41
141 0.4
142 0.4
143 0.41
144 0.38
145 0.32
146 0.27
147 0.25
148 0.25
149 0.24
150 0.22
151 0.15
152 0.13
153 0.17
154 0.21
155 0.24
156 0.22
157 0.23
158 0.28
159 0.33
160 0.37
161 0.4
162 0.43
163 0.45
164 0.54
165 0.6
166 0.58
167 0.57
168 0.55
169 0.49
170 0.43
171 0.37
172 0.28
173 0.22
174 0.21
175 0.2
176 0.16
177 0.17
178 0.15
179 0.2
180 0.22
181 0.24
182 0.26
183 0.26
184 0.31
185 0.32
186 0.36
187 0.36
188 0.4
189 0.46
190 0.48
191 0.51
192 0.46
193 0.45
194 0.44
195 0.39
196 0.35
197 0.3
198 0.28
199 0.22
200 0.22
201 0.21
202 0.19
203 0.19
204 0.2
205 0.17
206 0.16
207 0.19
208 0.19
209 0.19
210 0.21
211 0.2
212 0.18
213 0.17
214 0.15
215 0.15
216 0.13
217 0.12
218 0.14
219 0.16
220 0.17
221 0.17
222 0.17
223 0.14
224 0.16
225 0.15
226 0.12
227 0.15
228 0.15
229 0.18
230 0.19
231 0.19
232 0.26
233 0.3
234 0.32
235 0.28
236 0.32
237 0.32
238 0.36
239 0.39
240 0.37
241 0.36
242 0.35
243 0.35
244 0.3
245 0.28
246 0.28
247 0.26
248 0.23
249 0.22
250 0.22
251 0.27
252 0.35
253 0.43
254 0.49
255 0.57
256 0.6
257 0.62
258 0.62
259 0.57
260 0.54
261 0.46
262 0.46
263 0.39
264 0.35
265 0.37
266 0.38
267 0.4
268 0.35
269 0.38
270 0.3
271 0.29
272 0.31
273 0.28
274 0.29
275 0.28
276 0.35
277 0.32
278 0.31
279 0.31
280 0.29
281 0.26
282 0.23
283 0.28
284 0.21
285 0.21
286 0.19
287 0.18
288 0.17
289 0.16
290 0.19
291 0.14
292 0.18
293 0.2
294 0.21
295 0.23
296 0.23
297 0.25
298 0.28
299 0.35
300 0.39
301 0.45
302 0.53
303 0.61
304 0.7
305 0.75
306 0.76
307 0.77
308 0.76
309 0.77
310 0.76
311 0.73
312 0.72
313 0.72
314 0.73
315 0.73
316 0.75
317 0.74
318 0.77
319 0.76
320 0.75
321 0.79
322 0.8