Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L3B7

Protein Details
Accession T0L3B7    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
197-231TVEIGKKRKCLCVKYKKNRRRRKKFIFTSCKLDAFHydrophilic
NLS Segment(s)
PositionSequence
211-220YKKNRRRRKK
Subcellular Location(s) nucl 15, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR045252  LPCAT1-like  
Gene Ontology GO:0008374  F:O-acyltransferase activity  
CDD cd07991  LPLAT_LPCAT1-like  
Amino Acid Sequences MPMLVFPEGTCVNNKYVVMFQKGVFELDVEICPVSIKFDRTLQDPYWNRRRLGFTLQLLYLMSRWYLEADVHWLPPLKRKEIENATNFAERTRRIIAKASNLKVSLWNGYLKSSPAFKDRDLLKVAFLKTYTKLKRFSEEIIYDTDIDRTTYNNYTVFNLCKYKDFLILVLEEYYIYKSLSILEQEHLISQLAIKNTVEIGKKRKCLCVKYKKNRRRRKKFIFTSCKLDAFKKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.25
4 0.29
5 0.31
6 0.31
7 0.29
8 0.32
9 0.33
10 0.31
11 0.26
12 0.21
13 0.17
14 0.17
15 0.17
16 0.11
17 0.11
18 0.1
19 0.1
20 0.09
21 0.12
22 0.13
23 0.15
24 0.16
25 0.21
26 0.24
27 0.26
28 0.32
29 0.3
30 0.37
31 0.42
32 0.48
33 0.54
34 0.56
35 0.54
36 0.54
37 0.57
38 0.51
39 0.52
40 0.51
41 0.44
42 0.43
43 0.42
44 0.37
45 0.32
46 0.28
47 0.21
48 0.13
49 0.1
50 0.06
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.12
57 0.13
58 0.13
59 0.14
60 0.16
61 0.16
62 0.23
63 0.27
64 0.27
65 0.28
66 0.3
67 0.37
68 0.42
69 0.5
70 0.45
71 0.44
72 0.42
73 0.42
74 0.4
75 0.33
76 0.27
77 0.2
78 0.21
79 0.22
80 0.21
81 0.2
82 0.25
83 0.26
84 0.33
85 0.4
86 0.38
87 0.36
88 0.35
89 0.34
90 0.32
91 0.3
92 0.22
93 0.16
94 0.16
95 0.14
96 0.14
97 0.15
98 0.13
99 0.13
100 0.13
101 0.13
102 0.15
103 0.17
104 0.16
105 0.21
106 0.22
107 0.25
108 0.26
109 0.24
110 0.22
111 0.24
112 0.25
113 0.19
114 0.19
115 0.17
116 0.16
117 0.25
118 0.28
119 0.28
120 0.33
121 0.34
122 0.38
123 0.38
124 0.39
125 0.37
126 0.33
127 0.3
128 0.27
129 0.27
130 0.23
131 0.21
132 0.19
133 0.12
134 0.12
135 0.1
136 0.09
137 0.11
138 0.13
139 0.14
140 0.14
141 0.15
142 0.17
143 0.19
144 0.2
145 0.2
146 0.21
147 0.21
148 0.22
149 0.24
150 0.23
151 0.25
152 0.24
153 0.21
154 0.19
155 0.19
156 0.17
157 0.14
158 0.13
159 0.09
160 0.09
161 0.09
162 0.08
163 0.08
164 0.07
165 0.06
166 0.08
167 0.09
168 0.11
169 0.12
170 0.12
171 0.14
172 0.14
173 0.14
174 0.14
175 0.13
176 0.1
177 0.1
178 0.13
179 0.12
180 0.13
181 0.13
182 0.13
183 0.13
184 0.18
185 0.22
186 0.24
187 0.32
188 0.39
189 0.46
190 0.49
191 0.58
192 0.61
193 0.66
194 0.72
195 0.74
196 0.77
197 0.81
198 0.89
199 0.9
200 0.93
201 0.95
202 0.95
203 0.95
204 0.95
205 0.95
206 0.95
207 0.96
208 0.96
209 0.96
210 0.9
211 0.87
212 0.81
213 0.76
214 0.68