Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

T0M8X8

Protein Details
Accession T0M8X8    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-69RDCPIRKKINDKNVNRDIKRBasic
NLS Segment(s)
Subcellular Location(s) mito 16.5, cyto_mito 10.833, cyto_nucl 4.333, cyto 4, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036890  HATPase_C_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
Amino Acid Sequences MALNTIKNTSTLTIKSKHSKNKHALIKINNKISKCAREQGTTIIVADLFRDCPIRKKINDKNVNRDIKRVIELCGAYSVVCMCFVCVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.42
3 0.49
4 0.57
5 0.61
6 0.67
7 0.7
8 0.75
9 0.77
10 0.75
11 0.75
12 0.74
13 0.76
14 0.73
15 0.73
16 0.67
17 0.59
18 0.57
19 0.54
20 0.5
21 0.43
22 0.43
23 0.37
24 0.35
25 0.36
26 0.33
27 0.31
28 0.26
29 0.22
30 0.15
31 0.12
32 0.1
33 0.09
34 0.07
35 0.05
36 0.05
37 0.08
38 0.08
39 0.15
40 0.22
41 0.28
42 0.31
43 0.41
44 0.49
45 0.58
46 0.68
47 0.67
48 0.7
49 0.73
50 0.8
51 0.71
52 0.66
53 0.59
54 0.52
55 0.51
56 0.43
57 0.35
58 0.31
59 0.3
60 0.27
61 0.25
62 0.22
63 0.17
64 0.16
65 0.15
66 0.1
67 0.11
68 0.09