Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L805

Protein Details
Accession T0L805   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-37YDKTIGRTKIRIKKGKQIKEELEHydrophilic
NLS Segment(s)
PositionSequence
23-29KIRIKKG
Subcellular Location(s) nucl 12.5, cyto_nucl 11, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR006555  ATP-dep_Helicase_C  
IPR045028  DinG/Rad3-like  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004386  F:helicase activity  
GO:0016818  F:hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides  
GO:0003676  F:nucleic acid binding  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF13307  Helicase_C_2  
Amino Acid Sequences MFKKFKEKSQQIKNYDKTIGRTKIRIKKGKQIKEELEEIGITKEFMTIYKDALFSIEKEEEAKDLVNRNTWNIIESLDQILSALLFTNCDVYSYAFTKEENNYKNNVIYSYNFWLMDSAYIFGPFVKQVKSLVILSGTLNPFASFTSELGHKFNHQIMAPHLITEKQVFISCLKTGHLKQEIVGTYTKSDNLTYLDQIAKVIYDTAIKVSPHGGTLVFVPSYAFLDNLYKRVKNFNIENLFIEPKSGSQGEFEKILKKYHNRISLKVPVVLLCVYRGKAAEGMDFKDSSARAVICVGIPYPSLVDPQIELKKNTMMNTNILKVINGMRHRLLEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.76
3 0.69
4 0.64
5 0.64
6 0.65
7 0.59
8 0.62
9 0.66
10 0.68
11 0.75
12 0.78
13 0.74
14 0.76
15 0.81
16 0.83
17 0.81
18 0.81
19 0.77
20 0.73
21 0.71
22 0.62
23 0.52
24 0.43
25 0.35
26 0.27
27 0.2
28 0.14
29 0.11
30 0.11
31 0.09
32 0.1
33 0.13
34 0.12
35 0.14
36 0.16
37 0.16
38 0.15
39 0.17
40 0.18
41 0.14
42 0.19
43 0.18
44 0.16
45 0.17
46 0.17
47 0.16
48 0.16
49 0.16
50 0.14
51 0.2
52 0.21
53 0.25
54 0.25
55 0.27
56 0.29
57 0.28
58 0.25
59 0.19
60 0.19
61 0.15
62 0.16
63 0.16
64 0.12
65 0.12
66 0.1
67 0.1
68 0.08
69 0.07
70 0.07
71 0.05
72 0.05
73 0.05
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.13
80 0.14
81 0.16
82 0.14
83 0.15
84 0.18
85 0.22
86 0.29
87 0.29
88 0.3
89 0.31
90 0.32
91 0.34
92 0.31
93 0.28
94 0.22
95 0.19
96 0.21
97 0.22
98 0.23
99 0.21
100 0.2
101 0.18
102 0.16
103 0.16
104 0.12
105 0.09
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.09
113 0.09
114 0.09
115 0.1
116 0.11
117 0.14
118 0.13
119 0.12
120 0.11
121 0.11
122 0.11
123 0.15
124 0.14
125 0.12
126 0.11
127 0.11
128 0.1
129 0.1
130 0.11
131 0.07
132 0.07
133 0.08
134 0.1
135 0.11
136 0.12
137 0.13
138 0.12
139 0.13
140 0.15
141 0.15
142 0.14
143 0.14
144 0.15
145 0.2
146 0.19
147 0.17
148 0.16
149 0.14
150 0.15
151 0.14
152 0.13
153 0.07
154 0.08
155 0.08
156 0.09
157 0.1
158 0.1
159 0.1
160 0.1
161 0.13
162 0.14
163 0.19
164 0.22
165 0.2
166 0.2
167 0.25
168 0.25
169 0.23
170 0.23
171 0.17
172 0.15
173 0.15
174 0.16
175 0.11
176 0.11
177 0.1
178 0.12
179 0.13
180 0.12
181 0.13
182 0.13
183 0.12
184 0.12
185 0.11
186 0.08
187 0.07
188 0.07
189 0.05
190 0.05
191 0.06
192 0.07
193 0.1
194 0.1
195 0.1
196 0.11
197 0.11
198 0.1
199 0.11
200 0.09
201 0.07
202 0.08
203 0.1
204 0.08
205 0.08
206 0.07
207 0.07
208 0.08
209 0.08
210 0.07
211 0.06
212 0.12
213 0.13
214 0.17
215 0.21
216 0.21
217 0.22
218 0.29
219 0.31
220 0.32
221 0.35
222 0.39
223 0.41
224 0.41
225 0.42
226 0.38
227 0.37
228 0.3
229 0.28
230 0.19
231 0.14
232 0.16
233 0.15
234 0.12
235 0.13
236 0.16
237 0.16
238 0.19
239 0.2
240 0.23
241 0.24
242 0.28
243 0.32
244 0.36
245 0.43
246 0.48
247 0.57
248 0.55
249 0.57
250 0.61
251 0.63
252 0.59
253 0.53
254 0.45
255 0.36
256 0.34
257 0.32
258 0.24
259 0.18
260 0.18
261 0.15
262 0.16
263 0.16
264 0.15
265 0.17
266 0.18
267 0.21
268 0.2
269 0.22
270 0.24
271 0.23
272 0.22
273 0.23
274 0.22
275 0.18
276 0.19
277 0.16
278 0.14
279 0.15
280 0.16
281 0.13
282 0.14
283 0.13
284 0.1
285 0.1
286 0.1
287 0.11
288 0.11
289 0.12
290 0.11
291 0.12
292 0.12
293 0.2
294 0.28
295 0.3
296 0.31
297 0.32
298 0.37
299 0.39
300 0.4
301 0.39
302 0.34
303 0.36
304 0.4
305 0.41
306 0.39
307 0.36
308 0.34
309 0.29
310 0.32
311 0.33
312 0.31
313 0.33
314 0.32