Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0L115

Protein Details
Accession T0L115    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-34IYIKRKLKLFFKERNNFNKKFSQNKRKFSFREKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MIYIKRKLKLFFKERNNFNKKFSQNKRKFSFREKTSNFFVYKEIFNIIKDAQLKMIKIFKDYENCFLNFVDKKYEKELYELEKDFNEIIGNKEDFKISQEFFIDSKKQIKCKINLIIDEIENEFTKYLLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.84
4 0.77
5 0.73
6 0.73
7 0.69
8 0.7
9 0.73
10 0.73
11 0.74
12 0.81
13 0.83
14 0.83
15 0.81
16 0.8
17 0.79
18 0.75
19 0.76
20 0.7
21 0.68
22 0.64
23 0.64
24 0.55
25 0.46
26 0.4
27 0.32
28 0.28
29 0.24
30 0.21
31 0.16
32 0.15
33 0.16
34 0.15
35 0.15
36 0.16
37 0.15
38 0.17
39 0.18
40 0.18
41 0.18
42 0.22
43 0.19
44 0.19
45 0.21
46 0.19
47 0.25
48 0.26
49 0.29
50 0.27
51 0.27
52 0.26
53 0.24
54 0.25
55 0.2
56 0.19
57 0.22
58 0.21
59 0.22
60 0.25
61 0.29
62 0.25
63 0.27
64 0.29
65 0.26
66 0.3
67 0.29
68 0.26
69 0.22
70 0.23
71 0.2
72 0.18
73 0.14
74 0.09
75 0.11
76 0.14
77 0.15
78 0.14
79 0.15
80 0.15
81 0.14
82 0.17
83 0.19
84 0.15
85 0.16
86 0.17
87 0.18
88 0.18
89 0.23
90 0.23
91 0.22
92 0.29
93 0.32
94 0.37
95 0.44
96 0.51
97 0.51
98 0.57
99 0.63
100 0.61
101 0.58
102 0.57
103 0.52
104 0.44
105 0.41
106 0.34
107 0.28
108 0.22
109 0.2
110 0.16