Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A081CCM7

Protein Details
Accession A0A081CCM7    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
69-90AATPSKKPRRSAPRPSQHPPLCHydrophilic
NLS Segment(s)
PositionSequence
74-78KKPRR
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 8
Family & Domain DBs
Amino Acid Sequences MPDSTRKYGRKRAFLQDPWVRSESEFQLLSGSAPQPQQGGLRERGKTRGSLGPAPLPGLAWLASHRFQAATPSKKPRRSAPRPSQHPPLCLTPSQAENGLAPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.74
4 0.68
5 0.63
6 0.57
7 0.48
8 0.39
9 0.38
10 0.31
11 0.28
12 0.25
13 0.2
14 0.19
15 0.18
16 0.18
17 0.15
18 0.13
19 0.11
20 0.11
21 0.11
22 0.1
23 0.11
24 0.13
25 0.15
26 0.19
27 0.23
28 0.28
29 0.3
30 0.31
31 0.35
32 0.34
33 0.31
34 0.3
35 0.27
36 0.26
37 0.26
38 0.26
39 0.23
40 0.22
41 0.22
42 0.18
43 0.14
44 0.11
45 0.09
46 0.08
47 0.06
48 0.07
49 0.09
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.17
56 0.25
57 0.28
58 0.34
59 0.45
60 0.53
61 0.59
62 0.63
63 0.65
64 0.67
65 0.71
66 0.76
67 0.76
68 0.79
69 0.81
70 0.84
71 0.85
72 0.79
73 0.72
74 0.65
75 0.61
76 0.54
77 0.47
78 0.45
79 0.38
80 0.35
81 0.35
82 0.32
83 0.26
84 0.23