Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A081CBV3

Protein Details
Accession A0A081CBV3    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-124EYQPSQRIRKRRHGFLARNKTRNGRKTLMRRKFRGKAKLSHBasic
NLS Segment(s)
PositionSequence
90-124RIRKRRHGFLARNKTRNGRKTLMRRKFRGKAKLSH
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRISPFRALVRLPSVAPTTRTLAAPICTPSLRANTTTHSPLLSRLAPRTSPSPFSAPSVLALVAAPAPVATLGQMRTVTYGSEYQPSQRIRKRRHGFLARNKTRNGRKTLMRRKFRGKAKLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.26
4 0.28
5 0.26
6 0.25
7 0.25
8 0.25
9 0.23
10 0.22
11 0.21
12 0.21
13 0.2
14 0.19
15 0.17
16 0.19
17 0.2
18 0.22
19 0.22
20 0.22
21 0.22
22 0.23
23 0.27
24 0.28
25 0.26
26 0.22
27 0.2
28 0.2
29 0.22
30 0.21
31 0.19
32 0.19
33 0.21
34 0.21
35 0.23
36 0.24
37 0.23
38 0.23
39 0.23
40 0.24
41 0.22
42 0.24
43 0.23
44 0.19
45 0.17
46 0.15
47 0.12
48 0.09
49 0.08
50 0.06
51 0.05
52 0.04
53 0.04
54 0.03
55 0.03
56 0.02
57 0.02
58 0.03
59 0.04
60 0.05
61 0.06
62 0.07
63 0.07
64 0.08
65 0.09
66 0.08
67 0.09
68 0.11
69 0.1
70 0.13
71 0.14
72 0.15
73 0.22
74 0.25
75 0.32
76 0.37
77 0.45
78 0.5
79 0.61
80 0.67
81 0.69
82 0.76
83 0.78
84 0.82
85 0.84
86 0.87
87 0.86
88 0.84
89 0.79
90 0.78
91 0.77
92 0.75
93 0.71
94 0.67
95 0.67
96 0.73
97 0.8
98 0.81
99 0.81
100 0.81
101 0.84
102 0.86
103 0.86
104 0.85