Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A081CK98

Protein Details
Accession A0A081CK98   
Localization Confidence High
Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
429-451EAQSERRRSQSPRPERRHREEGGBasic
463-557HKSSSSHRDREHREHREHRSHRRDRSRERQDERDRDRGSRHRDDDRRRGDQVDRERRHRFDHEHREHRHRRERRDESNSHRRHKRHDDEHADELHBasic
NLS Segment(s)
PositionSequence
434-549RRRSQSPRPERRHREEGGEERSRSRRDQDHKSSSSHRDREHREHREHRSHRRDRSRERQDERDRDRGSRHRDDDRRRGDQVDRERRHRFDHEHREHRHRRERRDESNSHRRHKRHD
558-561RKRS
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR033194  MFAP1  
IPR009730  MFAP1_C  
Pfam View protein in Pfam  
PF06991  MFAP1  
Amino Acid Sequences MAPATQPKAAARVARPAARYRPGKAPVGAAGSLDDFSDSDNDEHADDHDSRHTAAPTSVSISDLSSGTAALQSSAQRRTAGIVIADPSSSAKKISVRLNAAAEPTRAQEQDDSSEYETDTSEEDAKPAQARPVFRKPGAPSQPAQKDESSEYETDTDDESSEEDATPPPLAKPIFVPKRARTTIAAGPADTEAAQEDVEAKAEEEAAKRRQEAHDLAAATIKRQLAEKEYQETHATDVDDTDGLDPEAEFEAWRQRELARLQRDREALDEKRKAQAELDAFRALPESEKDRLGRERAKQQAAEKREQRGNPAFLQKYYHKGSFFQDMDILQRDYTEATSSQVDVSKLPKMMQVRNFGAKGRSKWTHLANEDTSKSAMKLDAASACFVCGGPHMKKDCPQRGGAEGSGANRADLGDGVEASRTWGESAREAQSERRRSQSPRPERRHREEGGEERSRSRRDQDHKSSSSHRDREHREHREHRSHRRDRSRERQDERDRDRGSRHRDDDRRRGDQVDRERRHRFDHEHREHRHRRERRDESNSHRRHKRHDDEHADELHRKRSRHTSPPPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.48
3 0.51
4 0.55
5 0.58
6 0.6
7 0.55
8 0.58
9 0.59
10 0.61
11 0.55
12 0.51
13 0.46
14 0.45
15 0.41
16 0.31
17 0.27
18 0.22
19 0.2
20 0.17
21 0.13
22 0.08
23 0.09
24 0.1
25 0.11
26 0.1
27 0.11
28 0.12
29 0.12
30 0.13
31 0.13
32 0.16
33 0.15
34 0.17
35 0.2
36 0.21
37 0.22
38 0.25
39 0.25
40 0.22
41 0.23
42 0.23
43 0.2
44 0.22
45 0.21
46 0.18
47 0.17
48 0.16
49 0.16
50 0.14
51 0.13
52 0.09
53 0.09
54 0.08
55 0.09
56 0.09
57 0.07
58 0.09
59 0.13
60 0.18
61 0.22
62 0.23
63 0.23
64 0.23
65 0.25
66 0.25
67 0.23
68 0.19
69 0.17
70 0.17
71 0.17
72 0.17
73 0.14
74 0.14
75 0.14
76 0.14
77 0.13
78 0.14
79 0.17
80 0.24
81 0.31
82 0.36
83 0.38
84 0.42
85 0.44
86 0.43
87 0.43
88 0.39
89 0.33
90 0.26
91 0.24
92 0.24
93 0.21
94 0.21
95 0.2
96 0.2
97 0.23
98 0.24
99 0.25
100 0.23
101 0.23
102 0.22
103 0.2
104 0.18
105 0.14
106 0.13
107 0.11
108 0.13
109 0.12
110 0.13
111 0.13
112 0.15
113 0.16
114 0.16
115 0.21
116 0.21
117 0.26
118 0.33
119 0.42
120 0.47
121 0.46
122 0.52
123 0.51
124 0.58
125 0.61
126 0.57
127 0.49
128 0.53
129 0.59
130 0.54
131 0.53
132 0.43
133 0.38
134 0.37
135 0.39
136 0.33
137 0.26
138 0.24
139 0.22
140 0.22
141 0.2
142 0.18
143 0.14
144 0.1
145 0.1
146 0.09
147 0.09
148 0.1
149 0.09
150 0.08
151 0.09
152 0.1
153 0.1
154 0.1
155 0.09
156 0.12
157 0.12
158 0.12
159 0.15
160 0.25
161 0.32
162 0.38
163 0.44
164 0.45
165 0.54
166 0.55
167 0.54
168 0.46
169 0.44
170 0.41
171 0.42
172 0.38
173 0.28
174 0.28
175 0.25
176 0.23
177 0.17
178 0.13
179 0.06
180 0.06
181 0.06
182 0.05
183 0.06
184 0.05
185 0.06
186 0.06
187 0.06
188 0.06
189 0.06
190 0.08
191 0.09
192 0.14
193 0.18
194 0.2
195 0.2
196 0.24
197 0.25
198 0.29
199 0.29
200 0.26
201 0.26
202 0.25
203 0.24
204 0.25
205 0.23
206 0.18
207 0.19
208 0.16
209 0.12
210 0.13
211 0.14
212 0.15
213 0.21
214 0.23
215 0.25
216 0.25
217 0.27
218 0.27
219 0.27
220 0.23
221 0.2
222 0.18
223 0.13
224 0.12
225 0.1
226 0.09
227 0.09
228 0.08
229 0.06
230 0.05
231 0.05
232 0.05
233 0.05
234 0.06
235 0.05
236 0.05
237 0.05
238 0.12
239 0.13
240 0.13
241 0.13
242 0.12
243 0.18
244 0.22
245 0.29
246 0.32
247 0.37
248 0.39
249 0.43
250 0.43
251 0.39
252 0.38
253 0.36
254 0.31
255 0.34
256 0.37
257 0.33
258 0.37
259 0.37
260 0.35
261 0.29
262 0.29
263 0.25
264 0.23
265 0.24
266 0.2
267 0.19
268 0.18
269 0.18
270 0.14
271 0.1
272 0.09
273 0.11
274 0.12
275 0.14
276 0.15
277 0.17
278 0.2
279 0.24
280 0.29
281 0.29
282 0.36
283 0.41
284 0.43
285 0.43
286 0.47
287 0.49
288 0.48
289 0.52
290 0.48
291 0.47
292 0.49
293 0.47
294 0.47
295 0.45
296 0.43
297 0.39
298 0.43
299 0.38
300 0.33
301 0.37
302 0.32
303 0.32
304 0.33
305 0.32
306 0.25
307 0.26
308 0.28
309 0.32
310 0.3
311 0.25
312 0.22
313 0.2
314 0.21
315 0.21
316 0.2
317 0.11
318 0.11
319 0.11
320 0.1
321 0.1
322 0.09
323 0.07
324 0.08
325 0.09
326 0.09
327 0.1
328 0.11
329 0.11
330 0.11
331 0.13
332 0.14
333 0.15
334 0.15
335 0.17
336 0.19
337 0.25
338 0.29
339 0.34
340 0.34
341 0.38
342 0.39
343 0.37
344 0.38
345 0.37
346 0.34
347 0.35
348 0.34
349 0.33
350 0.37
351 0.41
352 0.43
353 0.4
354 0.43
355 0.39
356 0.41
357 0.38
358 0.35
359 0.3
360 0.23
361 0.21
362 0.17
363 0.14
364 0.1
365 0.1
366 0.11
367 0.13
368 0.13
369 0.14
370 0.13
371 0.13
372 0.12
373 0.11
374 0.09
375 0.08
376 0.13
377 0.14
378 0.21
379 0.24
380 0.26
381 0.32
382 0.42
383 0.48
384 0.46
385 0.46
386 0.43
387 0.44
388 0.45
389 0.39
390 0.32
391 0.25
392 0.23
393 0.24
394 0.21
395 0.17
396 0.13
397 0.13
398 0.1
399 0.09
400 0.09
401 0.06
402 0.06
403 0.06
404 0.07
405 0.06
406 0.07
407 0.07
408 0.07
409 0.07
410 0.1
411 0.11
412 0.14
413 0.18
414 0.2
415 0.21
416 0.22
417 0.3
418 0.36
419 0.43
420 0.43
421 0.46
422 0.48
423 0.52
424 0.61
425 0.64
426 0.66
427 0.69
428 0.76
429 0.81
430 0.86
431 0.89
432 0.87
433 0.79
434 0.75
435 0.73
436 0.71
437 0.69
438 0.67
439 0.59
440 0.57
441 0.6
442 0.56
443 0.5
444 0.49
445 0.49
446 0.5
447 0.59
448 0.64
449 0.68
450 0.67
451 0.7
452 0.71
453 0.71
454 0.73
455 0.69
456 0.65
457 0.65
458 0.7
459 0.75
460 0.79
461 0.78
462 0.78
463 0.81
464 0.84
465 0.86
466 0.87
467 0.87
468 0.88
469 0.88
470 0.88
471 0.9
472 0.9
473 0.9
474 0.91
475 0.92
476 0.91
477 0.89
478 0.89
479 0.89
480 0.89
481 0.86
482 0.84
483 0.77
484 0.7
485 0.72
486 0.7
487 0.69
488 0.68
489 0.67
490 0.68
491 0.74
492 0.8
493 0.82
494 0.81
495 0.79
496 0.72
497 0.7
498 0.66
499 0.66
500 0.67
501 0.67
502 0.66
503 0.68
504 0.72
505 0.71
506 0.72
507 0.71
508 0.69
509 0.69
510 0.73
511 0.75
512 0.78
513 0.82
514 0.86
515 0.87
516 0.89
517 0.88
518 0.86
519 0.86
520 0.87
521 0.89
522 0.89
523 0.89
524 0.88
525 0.87
526 0.89
527 0.88
528 0.86
529 0.86
530 0.81
531 0.81
532 0.83
533 0.84
534 0.83
535 0.84
536 0.84
537 0.81
538 0.82
539 0.78
540 0.71
541 0.68
542 0.61
543 0.6
544 0.56
545 0.5
546 0.51
547 0.55
548 0.6
549 0.63
550 0.7