Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A081CBA0

Protein Details
Accession A0A081CBA0   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
41-72QHPPASSAVKKQDKKRKARKPGHRSQSPMQASHydrophilic
77-102DVQTAELKRRQKPSHRRQYLRGALKTHydrophilic
NLS Segment(s)
PositionSequence
49-64VKKQDKKRKARKPGHR
Subcellular Location(s) nucl 9.5, cyto_nucl 7, extr 6, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAATAAENAAAAAADTAAVAALAAATYAPPASTTAATAARQHPPASSAVKKQDKKRKARKPGHRSQSPMQASQAHHDVQTAELKRRQKPSHRRQYLRGALKTRHWADEPCGTCQAAGKQCVAPPDDGHQEKCLRCSANAEPCGKRWILEQTSATTMLNLLSTKRHVRIIDLGWLVAERQVYGEHSGGPFDKCKDYSSVLRLDQPAPGRRLYPPGTRVLIPFVGRSNTPILAPGLRLSYSSHPAGYQTPGALHDGSLRSQDEDLEPRPSRTQDKCIINDNRSIDALLLAHVARRTKTPTAARAARSTNGTSAAIYNLNTDHHPQHKPHAGRTLHQRPKTIAISVVSPSRALYATMACVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.04
4 0.03
5 0.03
6 0.03
7 0.02
8 0.03
9 0.02
10 0.02
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.05
17 0.06
18 0.09
19 0.09
20 0.1
21 0.13
22 0.17
23 0.18
24 0.23
25 0.26
26 0.29
27 0.31
28 0.31
29 0.29
30 0.27
31 0.31
32 0.32
33 0.33
34 0.35
35 0.43
36 0.52
37 0.58
38 0.67
39 0.73
40 0.76
41 0.82
42 0.86
43 0.87
44 0.88
45 0.92
46 0.93
47 0.93
48 0.93
49 0.93
50 0.9
51 0.86
52 0.81
53 0.81
54 0.74
55 0.65
56 0.57
57 0.53
58 0.47
59 0.44
60 0.41
61 0.31
62 0.27
63 0.26
64 0.23
65 0.19
66 0.25
67 0.24
68 0.26
69 0.31
70 0.37
71 0.43
72 0.52
73 0.58
74 0.61
75 0.69
76 0.75
77 0.81
78 0.85
79 0.84
80 0.81
81 0.84
82 0.83
83 0.81
84 0.76
85 0.71
86 0.64
87 0.64
88 0.66
89 0.58
90 0.51
91 0.44
92 0.39
93 0.37
94 0.42
95 0.38
96 0.32
97 0.31
98 0.28
99 0.26
100 0.26
101 0.28
102 0.25
103 0.24
104 0.23
105 0.23
106 0.24
107 0.27
108 0.26
109 0.21
110 0.17
111 0.2
112 0.25
113 0.26
114 0.26
115 0.27
116 0.31
117 0.31
118 0.32
119 0.32
120 0.25
121 0.24
122 0.28
123 0.3
124 0.33
125 0.38
126 0.4
127 0.37
128 0.37
129 0.4
130 0.35
131 0.29
132 0.23
133 0.25
134 0.23
135 0.25
136 0.25
137 0.24
138 0.26
139 0.26
140 0.24
141 0.15
142 0.13
143 0.1
144 0.09
145 0.07
146 0.06
147 0.07
148 0.1
149 0.13
150 0.14
151 0.18
152 0.17
153 0.19
154 0.23
155 0.23
156 0.26
157 0.23
158 0.21
159 0.18
160 0.17
161 0.15
162 0.12
163 0.1
164 0.04
165 0.05
166 0.05
167 0.06
168 0.08
169 0.08
170 0.08
171 0.08
172 0.09
173 0.09
174 0.1
175 0.11
176 0.11
177 0.13
178 0.13
179 0.14
180 0.16
181 0.18
182 0.21
183 0.23
184 0.25
185 0.24
186 0.27
187 0.27
188 0.25
189 0.26
190 0.27
191 0.28
192 0.26
193 0.26
194 0.24
195 0.23
196 0.28
197 0.29
198 0.3
199 0.28
200 0.3
201 0.32
202 0.31
203 0.3
204 0.27
205 0.26
206 0.21
207 0.19
208 0.16
209 0.15
210 0.15
211 0.16
212 0.15
213 0.13
214 0.13
215 0.13
216 0.12
217 0.12
218 0.12
219 0.11
220 0.1
221 0.1
222 0.11
223 0.12
224 0.14
225 0.18
226 0.18
227 0.17
228 0.16
229 0.18
230 0.19
231 0.18
232 0.15
233 0.12
234 0.12
235 0.13
236 0.14
237 0.13
238 0.11
239 0.13
240 0.14
241 0.14
242 0.16
243 0.15
244 0.15
245 0.15
246 0.16
247 0.15
248 0.18
249 0.19
250 0.25
251 0.25
252 0.27
253 0.3
254 0.32
255 0.37
256 0.37
257 0.42
258 0.43
259 0.5
260 0.5
261 0.57
262 0.61
263 0.56
264 0.57
265 0.52
266 0.46
267 0.38
268 0.35
269 0.26
270 0.2
271 0.17
272 0.12
273 0.1
274 0.08
275 0.1
276 0.12
277 0.14
278 0.14
279 0.17
280 0.22
281 0.24
282 0.32
283 0.37
284 0.41
285 0.49
286 0.54
287 0.55
288 0.55
289 0.55
290 0.5
291 0.47
292 0.43
293 0.35
294 0.32
295 0.29
296 0.23
297 0.21
298 0.2
299 0.18
300 0.16
301 0.16
302 0.14
303 0.15
304 0.16
305 0.19
306 0.23
307 0.28
308 0.33
309 0.35
310 0.43
311 0.51
312 0.53
313 0.56
314 0.59
315 0.55
316 0.56
317 0.64
318 0.66
319 0.67
320 0.67
321 0.66
322 0.6
323 0.65
324 0.62
325 0.53
326 0.47
327 0.39
328 0.37
329 0.35
330 0.35
331 0.28
332 0.25
333 0.23
334 0.21
335 0.19
336 0.17
337 0.16
338 0.14