Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A081CJX0

Protein Details
Accession A0A081CJX0    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
258-286SDLKLDKPPLPKKTKAKKMKTIKLPGWDGHydrophilic
NLS Segment(s)
PositionSequence
264-293KPPLPKKTKAKKMKTIKLPGWDGVKAPRRW
Subcellular Location(s) mito 9, nucl 7.5, cyto_nucl 7.5, cyto 6.5, pero 4
Family & Domain DBs
Amino Acid Sequences MLLAALLFRSAGAFEIPEALKAGRELEQVLQKAQIDFPLLELSHTAPSGVRTSANELMASVQRARIAIAQHVTSIRHGADGSAVDHARRLQDELMRRVETHYSAQLQGAAVDKVEWQLHRGLADGVSASKQPHFVQNILRPAPELSELIRAQDETRFSFELRRLQAVLKRINPVSAYKRWRTRRLLAQISSEPGKKVQVGAKAQVGMNGGPTPWNIDMLRARLSSITALRSTQVASEASLAEAEAAAQRIETAAPIKSDLKLDKPPLPKKTKAKKMKTIKLPGWDGVKAPRRWAKTMHRVAPVDSWDDIPIPGMTPVPVVAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.12
3 0.13
4 0.13
5 0.15
6 0.14
7 0.14
8 0.15
9 0.17
10 0.14
11 0.15
12 0.17
13 0.2
14 0.26
15 0.27
16 0.28
17 0.28
18 0.27
19 0.27
20 0.26
21 0.23
22 0.19
23 0.17
24 0.17
25 0.18
26 0.17
27 0.16
28 0.16
29 0.16
30 0.15
31 0.15
32 0.14
33 0.1
34 0.13
35 0.15
36 0.15
37 0.14
38 0.14
39 0.2
40 0.24
41 0.24
42 0.22
43 0.2
44 0.22
45 0.22
46 0.23
47 0.18
48 0.15
49 0.15
50 0.15
51 0.16
52 0.16
53 0.15
54 0.17
55 0.19
56 0.18
57 0.19
58 0.2
59 0.2
60 0.18
61 0.19
62 0.14
63 0.13
64 0.12
65 0.11
66 0.11
67 0.11
68 0.11
69 0.13
70 0.13
71 0.12
72 0.13
73 0.14
74 0.14
75 0.14
76 0.15
77 0.14
78 0.19
79 0.26
80 0.3
81 0.34
82 0.33
83 0.33
84 0.33
85 0.32
86 0.29
87 0.25
88 0.23
89 0.2
90 0.2
91 0.2
92 0.19
93 0.17
94 0.15
95 0.14
96 0.11
97 0.08
98 0.08
99 0.08
100 0.08
101 0.1
102 0.09
103 0.09
104 0.11
105 0.12
106 0.12
107 0.12
108 0.11
109 0.1
110 0.1
111 0.08
112 0.07
113 0.07
114 0.08
115 0.08
116 0.08
117 0.1
118 0.11
119 0.16
120 0.17
121 0.18
122 0.24
123 0.29
124 0.35
125 0.33
126 0.32
127 0.28
128 0.26
129 0.25
130 0.2
131 0.15
132 0.09
133 0.14
134 0.14
135 0.14
136 0.14
137 0.13
138 0.12
139 0.14
140 0.15
141 0.1
142 0.13
143 0.13
144 0.13
145 0.16
146 0.18
147 0.22
148 0.22
149 0.22
150 0.2
151 0.22
152 0.24
153 0.27
154 0.3
155 0.26
156 0.28
157 0.27
158 0.27
159 0.26
160 0.27
161 0.27
162 0.3
163 0.33
164 0.36
165 0.45
166 0.51
167 0.58
168 0.6
169 0.61
170 0.63
171 0.66
172 0.68
173 0.61
174 0.59
175 0.52
176 0.48
177 0.44
178 0.35
179 0.27
180 0.2
181 0.19
182 0.14
183 0.16
184 0.17
185 0.22
186 0.23
187 0.25
188 0.26
189 0.26
190 0.26
191 0.25
192 0.22
193 0.15
194 0.14
195 0.12
196 0.1
197 0.09
198 0.09
199 0.1
200 0.09
201 0.12
202 0.11
203 0.14
204 0.17
205 0.19
206 0.22
207 0.19
208 0.19
209 0.17
210 0.17
211 0.17
212 0.16
213 0.16
214 0.14
215 0.14
216 0.14
217 0.14
218 0.14
219 0.12
220 0.12
221 0.1
222 0.1
223 0.1
224 0.1
225 0.1
226 0.09
227 0.08
228 0.06
229 0.06
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.06
238 0.06
239 0.07
240 0.08
241 0.09
242 0.12
243 0.14
244 0.14
245 0.19
246 0.21
247 0.24
248 0.3
249 0.34
250 0.39
251 0.48
252 0.55
253 0.61
254 0.66
255 0.7
256 0.74
257 0.8
258 0.83
259 0.84
260 0.86
261 0.86
262 0.9
263 0.91
264 0.9
265 0.89
266 0.84
267 0.82
268 0.76
269 0.7
270 0.64
271 0.55
272 0.46
273 0.46
274 0.49
275 0.42
276 0.46
277 0.49
278 0.5
279 0.52
280 0.58
281 0.6
282 0.61
283 0.7
284 0.69
285 0.7
286 0.67
287 0.66
288 0.63
289 0.55
290 0.47
291 0.38
292 0.32
293 0.25
294 0.24
295 0.21
296 0.18
297 0.15
298 0.13
299 0.12
300 0.12
301 0.11
302 0.1