Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A081CMP0

Protein Details
Accession A0A081CMP0    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-50RDEPSSSRRRRSPSPSRTRRDERDWRRDERBasic
180-201GAAQVKKERTWRQYMNRKGGFNHydrophilic
NLS Segment(s)
PositionSequence
27-43SRRRRSPSPSRTRRDER
81-98PRDRDRDDPRHEPPRPRP
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSGRRAPPAPRPYADAPRSYRDEPSSSRRRRSPSPSRTRRDERDWRRDERDDRDWRRDDRDDYRVRNRDTDRYHHDDRPRPRDRDRDDPRHEPPRPRPPAYNDERDRRVRDPPSTSRRSLSPPSTPQPLKPPAEPKEKETEGEGEAEEDADADADAMAAMMGFGGFGTTKGKKVDGNAAGAAQVKKERTWRQYMNRKGGFNRPLDKIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.55
4 0.55
5 0.6
6 0.55
7 0.53
8 0.47
9 0.49
10 0.47
11 0.52
12 0.56
13 0.57
14 0.64
15 0.65
16 0.68
17 0.71
18 0.76
19 0.77
20 0.77
21 0.8
22 0.83
23 0.83
24 0.86
25 0.86
26 0.84
27 0.83
28 0.82
29 0.82
30 0.82
31 0.81
32 0.79
33 0.77
34 0.77
35 0.74
36 0.7
37 0.7
38 0.69
39 0.7
40 0.72
41 0.7
42 0.65
43 0.66
44 0.63
45 0.59
46 0.55
47 0.58
48 0.56
49 0.57
50 0.64
51 0.64
52 0.61
53 0.63
54 0.6
55 0.59
56 0.56
57 0.56
58 0.54
59 0.54
60 0.57
61 0.56
62 0.6
63 0.6
64 0.64
65 0.67
66 0.67
67 0.65
68 0.66
69 0.7
70 0.68
71 0.7
72 0.71
73 0.71
74 0.69
75 0.71
76 0.71
77 0.71
78 0.69
79 0.66
80 0.66
81 0.66
82 0.67
83 0.63
84 0.61
85 0.57
86 0.62
87 0.6
88 0.6
89 0.55
90 0.54
91 0.56
92 0.56
93 0.54
94 0.47
95 0.48
96 0.43
97 0.42
98 0.43
99 0.46
100 0.51
101 0.52
102 0.52
103 0.46
104 0.44
105 0.45
106 0.44
107 0.39
108 0.37
109 0.38
110 0.4
111 0.46
112 0.44
113 0.41
114 0.43
115 0.46
116 0.42
117 0.4
118 0.45
119 0.44
120 0.53
121 0.53
122 0.49
123 0.51
124 0.49
125 0.45
126 0.38
127 0.35
128 0.25
129 0.25
130 0.21
131 0.13
132 0.12
133 0.11
134 0.09
135 0.06
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.02
146 0.02
147 0.02
148 0.02
149 0.02
150 0.02
151 0.02
152 0.03
153 0.03
154 0.08
155 0.1
156 0.13
157 0.15
158 0.17
159 0.18
160 0.22
161 0.31
162 0.29
163 0.31
164 0.29
165 0.28
166 0.28
167 0.3
168 0.27
169 0.2
170 0.21
171 0.19
172 0.22
173 0.31
174 0.38
175 0.41
176 0.51
177 0.58
178 0.65
179 0.74
180 0.81
181 0.83
182 0.8
183 0.79
184 0.74
185 0.75
186 0.71
187 0.68
188 0.65