Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A081CNP9

Protein Details
Accession A0A081CNP9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
359-380KDPMNPLNLGRRQRKKVVRIGRHydrophilic
NLS Segment(s)
PositionSequence
196-211EARKKRVRPSTIKKAA
229-252SSSKSKNKKGGSKEGAAATGGAKP
357-380KKKDPMNPLNLGRRQRKKVVRIGR
Subcellular Location(s) nucl 10, cyto 10, cyto_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR002778  Signal_recog_particle_SRP19  
IPR036521  SRP19-like_sf  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF01922  SRP19  
Amino Acid Sequences MPPKAAVEDFDDDFEFDLPTVSSPAVAQAQAGAGASAPQADQMAAFQKMMEQMGQAPGSGDFGSTRAPVGADMSGASGSKGKEDGEHKKWVSVYPIYFDAKRHYRKGCRRVSYEKASPFPTQLWIAKAVARLQLKYVQEPYKTHPQDWENPGRVKVQLFNDDGSALDSRFASKKQLFDAIAEILQPNCGGKPPALEARKKRVRPSTIKKAALAENAKAVSSGSQPAAGSSSKSKNKKGGSKEGAAATGGAKPTLTKEQRKQVLQAKRDPNPNPIRARLAKMRFPPTLEARLPAHSPAVEGGLLNMNLAEAMGGMPPGMPGADALGGLGGMLGGMGLGDDDDDEDDEDEAEKEEAAGKKKDPMNPLNLGRRQRKKVVRIGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.15
3 0.1
4 0.1
5 0.08
6 0.09
7 0.1
8 0.09
9 0.09
10 0.08
11 0.12
12 0.13
13 0.13
14 0.12
15 0.11
16 0.11
17 0.11
18 0.11
19 0.08
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.08
30 0.12
31 0.12
32 0.13
33 0.12
34 0.13
35 0.15
36 0.16
37 0.15
38 0.11
39 0.12
40 0.16
41 0.17
42 0.15
43 0.13
44 0.13
45 0.14
46 0.13
47 0.11
48 0.08
49 0.08
50 0.1
51 0.1
52 0.1
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.08
59 0.08
60 0.08
61 0.08
62 0.08
63 0.08
64 0.09
65 0.09
66 0.1
67 0.11
68 0.11
69 0.15
70 0.23
71 0.32
72 0.34
73 0.43
74 0.42
75 0.44
76 0.45
77 0.42
78 0.4
79 0.36
80 0.32
81 0.26
82 0.3
83 0.3
84 0.3
85 0.29
86 0.32
87 0.36
88 0.41
89 0.44
90 0.49
91 0.57
92 0.66
93 0.75
94 0.77
95 0.76
96 0.77
97 0.78
98 0.78
99 0.76
100 0.73
101 0.68
102 0.62
103 0.58
104 0.52
105 0.45
106 0.38
107 0.32
108 0.28
109 0.24
110 0.23
111 0.21
112 0.2
113 0.21
114 0.21
115 0.2
116 0.23
117 0.22
118 0.21
119 0.2
120 0.25
121 0.24
122 0.25
123 0.29
124 0.28
125 0.3
126 0.32
127 0.35
128 0.4
129 0.41
130 0.39
131 0.39
132 0.38
133 0.44
134 0.48
135 0.51
136 0.46
137 0.46
138 0.47
139 0.42
140 0.4
141 0.32
142 0.3
143 0.25
144 0.25
145 0.25
146 0.24
147 0.22
148 0.21
149 0.2
150 0.17
151 0.14
152 0.08
153 0.07
154 0.07
155 0.08
156 0.1
157 0.1
158 0.14
159 0.16
160 0.18
161 0.19
162 0.23
163 0.22
164 0.22
165 0.23
166 0.18
167 0.15
168 0.14
169 0.13
170 0.08
171 0.07
172 0.07
173 0.05
174 0.04
175 0.05
176 0.05
177 0.05
178 0.07
179 0.09
180 0.17
181 0.21
182 0.26
183 0.31
184 0.41
185 0.49
186 0.5
187 0.55
188 0.55
189 0.6
190 0.64
191 0.69
192 0.7
193 0.71
194 0.7
195 0.65
196 0.6
197 0.54
198 0.5
199 0.42
200 0.31
201 0.25
202 0.23
203 0.21
204 0.18
205 0.16
206 0.1
207 0.09
208 0.11
209 0.08
210 0.09
211 0.09
212 0.09
213 0.11
214 0.1
215 0.11
216 0.14
217 0.21
218 0.28
219 0.33
220 0.36
221 0.42
222 0.49
223 0.55
224 0.58
225 0.61
226 0.59
227 0.57
228 0.57
229 0.51
230 0.44
231 0.36
232 0.29
233 0.19
234 0.16
235 0.12
236 0.09
237 0.08
238 0.07
239 0.1
240 0.19
241 0.25
242 0.31
243 0.37
244 0.47
245 0.54
246 0.56
247 0.6
248 0.59
249 0.62
250 0.6
251 0.63
252 0.62
253 0.61
254 0.67
255 0.63
256 0.65
257 0.64
258 0.65
259 0.61
260 0.56
261 0.58
262 0.52
263 0.56
264 0.55
265 0.52
266 0.51
267 0.54
268 0.57
269 0.51
270 0.5
271 0.5
272 0.47
273 0.48
274 0.42
275 0.39
276 0.34
277 0.35
278 0.34
279 0.29
280 0.25
281 0.18
282 0.17
283 0.14
284 0.14
285 0.11
286 0.1
287 0.1
288 0.11
289 0.11
290 0.1
291 0.09
292 0.08
293 0.07
294 0.07
295 0.06
296 0.03
297 0.03
298 0.03
299 0.04
300 0.04
301 0.04
302 0.04
303 0.04
304 0.04
305 0.04
306 0.03
307 0.05
308 0.05
309 0.05
310 0.05
311 0.05
312 0.05
313 0.04
314 0.04
315 0.03
316 0.02
317 0.02
318 0.02
319 0.01
320 0.02
321 0.02
322 0.02
323 0.02
324 0.02
325 0.02
326 0.03
327 0.04
328 0.05
329 0.06
330 0.07
331 0.07
332 0.08
333 0.08
334 0.08
335 0.09
336 0.09
337 0.08
338 0.08
339 0.13
340 0.18
341 0.22
342 0.26
343 0.26
344 0.34
345 0.4
346 0.46
347 0.49
348 0.52
349 0.53
350 0.58
351 0.65
352 0.67
353 0.69
354 0.72
355 0.74
356 0.77
357 0.78
358 0.8
359 0.81
360 0.8