Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A081CP69

Protein Details
Accession A0A081CP69    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
9-35AAAASKSAKKKKWSKGKVKDKAQNMVVHydrophilic
NLS Segment(s)
PositionSequence
5-28KAAIAAAASKSAKKKKWSKGKVKD
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKKAAIAAAASKSAKKKKWSKGKVKDKAQNMVVLDRPTYDRILKEVPTFKMISQSTLIDRMKISGSLARVAIRHLEREGQIKRLVHHHGQLVYTRASAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.42
4 0.48
5 0.56
6 0.62
7 0.72
8 0.79
9 0.83
10 0.86
11 0.91
12 0.91
13 0.92
14 0.89
15 0.84
16 0.8
17 0.71
18 0.64
19 0.54
20 0.46
21 0.39
22 0.32
23 0.26
24 0.2
25 0.2
26 0.17
27 0.18
28 0.16
29 0.14
30 0.16
31 0.18
32 0.18
33 0.2
34 0.23
35 0.22
36 0.23
37 0.24
38 0.21
39 0.25
40 0.24
41 0.22
42 0.19
43 0.19
44 0.17
45 0.23
46 0.23
47 0.17
48 0.17
49 0.16
50 0.15
51 0.15
52 0.15
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.13
59 0.14
60 0.19
61 0.17
62 0.18
63 0.18
64 0.21
65 0.21
66 0.3
67 0.31
68 0.29
69 0.33
70 0.33
71 0.34
72 0.36
73 0.41
74 0.37
75 0.4
76 0.41
77 0.38
78 0.39
79 0.4
80 0.37
81 0.32