Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A081CFE0

Protein Details
Accession A0A081CFE0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
16-38LWKNPWRLSSPRKNRVRMRLRAVHydrophilic
78-105KHDRGFRKSVHKVPKWTRKTIRENPVGYBasic
NLS Segment(s)
Subcellular Location(s) mito 24.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRASMPSLGGLLWKNPWRLSSPRKNRVRMRLRAVDDVIATLQQSNIQCASLNRALAIPTESQMLPKDKYTTFSKHDRGFRKSVHKVPKWTRKTIRENPVGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.17
4 0.21
5 0.23
6 0.24
7 0.26
8 0.28
9 0.35
10 0.44
11 0.49
12 0.56
13 0.63
14 0.71
15 0.78
16 0.81
17 0.84
18 0.84
19 0.81
20 0.78
21 0.77
22 0.72
23 0.67
24 0.6
25 0.5
26 0.4
27 0.32
28 0.24
29 0.15
30 0.11
31 0.07
32 0.06
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.09
39 0.09
40 0.14
41 0.13
42 0.13
43 0.12
44 0.12
45 0.12
46 0.12
47 0.13
48 0.08
49 0.07
50 0.09
51 0.09
52 0.1
53 0.13
54 0.16
55 0.15
56 0.17
57 0.2
58 0.19
59 0.23
60 0.27
61 0.3
62 0.32
63 0.39
64 0.45
65 0.48
66 0.56
67 0.59
68 0.6
69 0.61
70 0.63
71 0.64
72 0.66
73 0.68
74 0.7
75 0.7
76 0.74
77 0.79
78 0.83
79 0.79
80 0.81
81 0.82
82 0.82
83 0.85
84 0.85
85 0.85