Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4NVI3

Protein Details
Accession A0A0G4NVI3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-50FDKLSTMSEKRKKKNATKRRRREHSRRVREREKELRRRPGEBasic
NLS Segment(s)
PositionSequence
19-51KRKKKNATKRRRREHSRRVREREKELRRRPGEK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MTMGWLRHIFDKLSTMSEKRKKKNATKRRRREHSRRVREREKELRRRPGEKAPLFFGSPFKTYEVNYRGPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.33
4 0.41
5 0.49
6 0.53
7 0.61
8 0.66
9 0.73
10 0.81
11 0.82
12 0.85
13 0.87
14 0.91
15 0.92
16 0.93
17 0.93
18 0.93
19 0.93
20 0.93
21 0.93
22 0.92
23 0.9
24 0.89
25 0.84
26 0.82
27 0.82
28 0.81
29 0.81
30 0.79
31 0.8
32 0.77
33 0.76
34 0.71
35 0.71
36 0.7
37 0.65
38 0.59
39 0.53
40 0.5
41 0.47
42 0.43
43 0.37
44 0.3
45 0.27
46 0.25
47 0.23
48 0.22
49 0.22
50 0.3
51 0.31
52 0.32