Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4NTY8

Protein Details
Accession A0A0G4NTY8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-84AQRREAILEKRRRRDQKPEGGVLBasic
NLS Segment(s)
PositionSequence
71-75KRRRR
Subcellular Location(s) mito 20, cyto 3, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVHKVLFWSGFGIAVRLWQLGIEMRPILAKESLWVYPLFAGVGGSFGYWLQGVESRQLKMLAQRREAILEKRRRRDQKPEGGVLAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.09
5 0.07
6 0.08
7 0.09
8 0.1
9 0.1
10 0.09
11 0.09
12 0.1
13 0.11
14 0.12
15 0.1
16 0.09
17 0.09
18 0.11
19 0.11
20 0.12
21 0.11
22 0.1
23 0.09
24 0.09
25 0.08
26 0.06
27 0.05
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.03
34 0.04
35 0.04
36 0.04
37 0.04
38 0.06
39 0.07
40 0.12
41 0.14
42 0.14
43 0.16
44 0.16
45 0.17
46 0.22
47 0.29
48 0.3
49 0.32
50 0.33
51 0.33
52 0.37
53 0.4
54 0.4
55 0.42
56 0.47
57 0.53
58 0.61
59 0.7
60 0.75
61 0.78
62 0.82
63 0.83
64 0.83
65 0.82
66 0.79
67 0.71
68 0.62