Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PML8

Protein Details
Accession A0A0G4PML8    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-60TSLSPPSQKKETKKNPTKMPIHQKEFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 8.5, cyto_nucl 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025979  ChrR-like_cupin_dom  
IPR014710  RmlC-like_jellyroll  
IPR011051  RmlC_Cupin_sf  
Pfam View protein in Pfam  
PF12973  Cupin_7  
Amino Acid Sequences MWTGSLKYNLKGTVPPSPALQKQPPHLPNIPHLATSLSPPSQKKETKKNPTKMPIHQKEFSTPPPHPPVGTPRDSPSALPWYSIAPGVWEFLLNGDEEHKAVLQWWEPNTVSAQTEPITHTYIEEVCTLRGGLEDLSFGESWGIGAYAYREPGMEHGPYQATKEGCLQFVKVVPVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.33
4 0.38
5 0.41
6 0.44
7 0.48
8 0.44
9 0.47
10 0.56
11 0.55
12 0.56
13 0.56
14 0.52
15 0.5
16 0.53
17 0.48
18 0.38
19 0.35
20 0.3
21 0.25
22 0.25
23 0.24
24 0.19
25 0.22
26 0.23
27 0.28
28 0.34
29 0.41
30 0.46
31 0.52
32 0.61
33 0.68
34 0.77
35 0.8
36 0.82
37 0.84
38 0.84
39 0.82
40 0.83
41 0.81
42 0.77
43 0.72
44 0.64
45 0.59
46 0.56
47 0.52
48 0.46
49 0.38
50 0.37
51 0.4
52 0.39
53 0.34
54 0.32
55 0.34
56 0.35
57 0.37
58 0.32
59 0.29
60 0.33
61 0.33
62 0.31
63 0.26
64 0.26
65 0.22
66 0.21
67 0.18
68 0.15
69 0.15
70 0.15
71 0.12
72 0.07
73 0.07
74 0.07
75 0.07
76 0.06
77 0.05
78 0.05
79 0.06
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.06
87 0.05
88 0.06
89 0.07
90 0.08
91 0.1
92 0.11
93 0.14
94 0.14
95 0.15
96 0.15
97 0.15
98 0.14
99 0.12
100 0.12
101 0.1
102 0.11
103 0.12
104 0.12
105 0.13
106 0.12
107 0.12
108 0.12
109 0.12
110 0.12
111 0.13
112 0.12
113 0.1
114 0.11
115 0.11
116 0.09
117 0.09
118 0.08
119 0.07
120 0.06
121 0.07
122 0.07
123 0.09
124 0.09
125 0.09
126 0.08
127 0.07
128 0.07
129 0.07
130 0.06
131 0.04
132 0.04
133 0.07
134 0.08
135 0.09
136 0.09
137 0.09
138 0.1
139 0.13
140 0.16
141 0.15
142 0.14
143 0.16
144 0.19
145 0.2
146 0.22
147 0.24
148 0.21
149 0.22
150 0.29
151 0.28
152 0.27
153 0.29
154 0.27
155 0.25
156 0.28
157 0.33