Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4NSU6

Protein Details
Accession A0A0G4NSU6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
4-27LAEAEKWDYKKKKKRTGSAPGLGSHydrophilic
NLS Segment(s)
PositionSequence
13-18KKKKKR
Subcellular Location(s) mito 12, nucl 10, cyto 3
Family & Domain DBs
Amino Acid Sequences MSSLAEAEKWDYKKKKKRTGSAPGLGSGSLRSTPYSVHLNLLFPLPSASAYNLALELDMFSVRHRFTTYHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.79
4 0.86
5 0.87
6 0.88
7 0.88
8 0.85
9 0.76
10 0.67
11 0.57
12 0.47
13 0.37
14 0.26
15 0.17
16 0.1
17 0.09
18 0.08
19 0.08
20 0.08
21 0.11
22 0.13
23 0.13
24 0.14
25 0.14
26 0.14
27 0.14
28 0.15
29 0.12
30 0.09
31 0.09
32 0.07
33 0.07
34 0.08
35 0.08
36 0.09
37 0.09
38 0.1
39 0.09
40 0.09
41 0.08
42 0.07
43 0.07
44 0.06
45 0.06
46 0.06
47 0.07
48 0.11
49 0.12
50 0.14
51 0.15