Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4P5D1

Protein Details
Accession A0A0G4P5D1    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
25-48IVLLIKMRRDRKKKDRELEKSFQPHydrophilic
NLS Segment(s)
PositionSequence
32-38RRDRKKK
Subcellular Location(s) mito 9, plas 6, nucl 4.5, cyto_nucl 4.5, cyto 3.5, extr 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGLLKLLLKVILIPIVVLIVIAVVIVLLIKMRRDRKKKDRELEKSFQPPPIQQWVPYTPVQQPAPAYVKTPGAMEQGIGHGQP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.05
5 0.04
6 0.02
7 0.02
8 0.02
9 0.02
10 0.01
11 0.02
12 0.02
13 0.02
14 0.03
15 0.03
16 0.05
17 0.11
18 0.2
19 0.3
20 0.38
21 0.48
22 0.59
23 0.69
24 0.78
25 0.82
26 0.84
27 0.85
28 0.85
29 0.8
30 0.76
31 0.71
32 0.63
33 0.57
34 0.48
35 0.39
36 0.34
37 0.38
38 0.32
39 0.26
40 0.3
41 0.28
42 0.31
43 0.31
44 0.3
45 0.24
46 0.3
47 0.29
48 0.26
49 0.25
50 0.26
51 0.29
52 0.27
53 0.26
54 0.22
55 0.24
56 0.22
57 0.23
58 0.19
59 0.18
60 0.18
61 0.16
62 0.15
63 0.16