Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PRP1

Protein Details
Accession A0A0G4PRP1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-60PTPTPKPTPKLPPKPPPKPTPKPKNVKSNTNHydrophilic
NLS Segment(s)
PositionSequence
30-54PTPTPKPTPKLPPKPPPKPTPKPKN
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MSLSFSFESKNQTPTPNSTPTPKPKPTPTPTPTPKPTPKLPPKPPPKPTPKPKNVKSNTNTKLNINIKFPFTFNLPSFTGQGAIGEAEHTTDRVTPRVNSRVVNPAKLLCTRDSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.46
3 0.45
4 0.45
5 0.45
6 0.51
7 0.56
8 0.61
9 0.61
10 0.61
11 0.63
12 0.71
13 0.71
14 0.73
15 0.68
16 0.69
17 0.7
18 0.73
19 0.7
20 0.69
21 0.7
22 0.65
23 0.67
24 0.67
25 0.7
26 0.72
27 0.75
28 0.77
29 0.79
30 0.83
31 0.84
32 0.83
33 0.82
34 0.82
35 0.84
36 0.85
37 0.84
38 0.84
39 0.84
40 0.85
41 0.8
42 0.8
43 0.72
44 0.71
45 0.66
46 0.63
47 0.57
48 0.47
49 0.51
50 0.46
51 0.45
52 0.38
53 0.36
54 0.31
55 0.3
56 0.3
57 0.22
58 0.2
59 0.21
60 0.18
61 0.21
62 0.2
63 0.21
64 0.21
65 0.2
66 0.19
67 0.14
68 0.14
69 0.1
70 0.08
71 0.07
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.09
79 0.11
80 0.14
81 0.17
82 0.19
83 0.26
84 0.33
85 0.35
86 0.34
87 0.36
88 0.44
89 0.45
90 0.44
91 0.39
92 0.36
93 0.37
94 0.4
95 0.4