Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PBR1

Protein Details
Accession A0A0G4PBR1   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
3-25DESPAQRSARLRRERREAKIKEGBasic
NLS Segment(s)
PositionSequence
12-24RLRRERREAKIKE
Subcellular Location(s) mito 8, plas 7, nucl 4, cyto 3, pero 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR028143  Get2/sif1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08690  GET2  
Amino Acid Sequences MADESPAQRSARLRRERREAKIKEGGSARLDKITSLSGRTPQAEREEASPSPQPQRAISASPSPGPQNPQFRPSPSPQPDMQSPEAIRAQQEAFFSMLRQSAPEPGQGVHPDPQAPNSLQAQQEAFRAMLRQSAQDQGQGQPPNDAEDPTIKLLNSLMGAIPGGDPNAPPGAPAAGAGNQPAPGFSPAAIATMLGVPPFIANMLGGATPPTEAEQKRARIWKTLHTVFALAVAVYLLFIIGTSVALFGSPPPKPATAQNPFAIFVTGELLLTGGKVLLGGKSGGMGMVVQLVKDVVRDGSLLLFILGMGTWYNREWQTTAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.77
3 0.82
4 0.85
5 0.86
6 0.81
7 0.79
8 0.79
9 0.71
10 0.66
11 0.61
12 0.55
13 0.5
14 0.5
15 0.42
16 0.37
17 0.36
18 0.3
19 0.28
20 0.28
21 0.25
22 0.23
23 0.25
24 0.26
25 0.3
26 0.32
27 0.32
28 0.32
29 0.36
30 0.35
31 0.34
32 0.31
33 0.32
34 0.29
35 0.32
36 0.32
37 0.31
38 0.34
39 0.36
40 0.35
41 0.32
42 0.37
43 0.35
44 0.34
45 0.33
46 0.33
47 0.31
48 0.31
49 0.32
50 0.3
51 0.29
52 0.32
53 0.36
54 0.39
55 0.39
56 0.43
57 0.44
58 0.45
59 0.49
60 0.48
61 0.53
62 0.48
63 0.5
64 0.47
65 0.49
66 0.49
67 0.5
68 0.46
69 0.41
70 0.35
71 0.35
72 0.35
73 0.3
74 0.26
75 0.22
76 0.21
77 0.18
78 0.18
79 0.15
80 0.14
81 0.14
82 0.14
83 0.13
84 0.13
85 0.11
86 0.11
87 0.11
88 0.15
89 0.15
90 0.16
91 0.16
92 0.15
93 0.18
94 0.18
95 0.2
96 0.18
97 0.18
98 0.19
99 0.18
100 0.19
101 0.19
102 0.18
103 0.19
104 0.18
105 0.2
106 0.19
107 0.19
108 0.19
109 0.17
110 0.17
111 0.15
112 0.13
113 0.1
114 0.1
115 0.09
116 0.12
117 0.11
118 0.12
119 0.12
120 0.16
121 0.16
122 0.17
123 0.18
124 0.17
125 0.22
126 0.23
127 0.21
128 0.2
129 0.19
130 0.2
131 0.19
132 0.18
133 0.13
134 0.13
135 0.14
136 0.14
137 0.14
138 0.11
139 0.11
140 0.1
141 0.1
142 0.08
143 0.07
144 0.05
145 0.04
146 0.05
147 0.04
148 0.05
149 0.04
150 0.04
151 0.04
152 0.04
153 0.05
154 0.06
155 0.05
156 0.05
157 0.05
158 0.05
159 0.05
160 0.06
161 0.05
162 0.06
163 0.07
164 0.07
165 0.07
166 0.08
167 0.08
168 0.07
169 0.08
170 0.07
171 0.07
172 0.07
173 0.08
174 0.07
175 0.08
176 0.08
177 0.07
178 0.06
179 0.06
180 0.06
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.03
187 0.03
188 0.03
189 0.03
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.04
196 0.05
197 0.06
198 0.11
199 0.11
200 0.17
201 0.23
202 0.27
203 0.32
204 0.39
205 0.39
206 0.41
207 0.43
208 0.46
209 0.49
210 0.49
211 0.45
212 0.39
213 0.38
214 0.3
215 0.29
216 0.21
217 0.11
218 0.08
219 0.06
220 0.05
221 0.04
222 0.04
223 0.03
224 0.02
225 0.02
226 0.02
227 0.02
228 0.03
229 0.03
230 0.03
231 0.03
232 0.03
233 0.04
234 0.05
235 0.11
236 0.11
237 0.14
238 0.16
239 0.18
240 0.19
241 0.26
242 0.34
243 0.35
244 0.4
245 0.41
246 0.4
247 0.4
248 0.39
249 0.33
250 0.23
251 0.17
252 0.14
253 0.11
254 0.09
255 0.08
256 0.07
257 0.06
258 0.06
259 0.06
260 0.04
261 0.03
262 0.04
263 0.04
264 0.05
265 0.06
266 0.06
267 0.06
268 0.07
269 0.07
270 0.06
271 0.06
272 0.06
273 0.04
274 0.09
275 0.09
276 0.09
277 0.09
278 0.09
279 0.09
280 0.1
281 0.11
282 0.07
283 0.07
284 0.08
285 0.08
286 0.09
287 0.09
288 0.09
289 0.08
290 0.07
291 0.06
292 0.06
293 0.05
294 0.05
295 0.05
296 0.06
297 0.08
298 0.08
299 0.14
300 0.15
301 0.18