Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PJP9

Protein Details
Accession A0A0G4PJP9   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
17-40ASTNQPPTRRKQHRSQPSHFARKLHydrophilic
55-77EPKAKVSRQAKRRLNKRMRRAAAHydrophilic
NLS Segment(s)
PositionSequence
25-75RRKQHRSQPSHFARKLRRAGLEVPELPKGDEPKAKVSRQAKRRLNKRMRRA
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MSSEKPVEERVAENESASTNQPPTRRKQHRSQPSHFARKLRRAGLEVPELPKGDEPKAKVSRQAKRRLNKRMRRAAAAAATTAAAITTTTAAAAPSPPIPEQESRVMAGSPKSKKDGDKPLDFGQPLTFRPKKGTTVVESHSHDLTLALRPKKGPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.21
4 0.21
5 0.19
6 0.18
7 0.22
8 0.28
9 0.31
10 0.39
11 0.48
12 0.57
13 0.61
14 0.68
15 0.75
16 0.8
17 0.85
18 0.83
19 0.82
20 0.82
21 0.86
22 0.79
23 0.77
24 0.75
25 0.74
26 0.75
27 0.69
28 0.62
29 0.54
30 0.55
31 0.51
32 0.49
33 0.42
34 0.37
35 0.34
36 0.32
37 0.28
38 0.26
39 0.24
40 0.21
41 0.21
42 0.21
43 0.28
44 0.34
45 0.34
46 0.4
47 0.46
48 0.51
49 0.56
50 0.64
51 0.63
52 0.66
53 0.74
54 0.78
55 0.8
56 0.81
57 0.83
58 0.82
59 0.77
60 0.72
61 0.64
62 0.57
63 0.48
64 0.4
65 0.29
66 0.19
67 0.16
68 0.12
69 0.1
70 0.06
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.05
82 0.06
83 0.08
84 0.08
85 0.09
86 0.12
87 0.13
88 0.17
89 0.2
90 0.2
91 0.19
92 0.2
93 0.18
94 0.17
95 0.2
96 0.24
97 0.24
98 0.26
99 0.29
100 0.31
101 0.35
102 0.42
103 0.49
104 0.49
105 0.51
106 0.53
107 0.53
108 0.56
109 0.52
110 0.45
111 0.39
112 0.35
113 0.31
114 0.35
115 0.34
116 0.3
117 0.36
118 0.39
119 0.38
120 0.41
121 0.45
122 0.4
123 0.44
124 0.47
125 0.48
126 0.48
127 0.46
128 0.41
129 0.35
130 0.3
131 0.24
132 0.22
133 0.23
134 0.27
135 0.27
136 0.29