Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0G4PT60

Protein Details
Accession A0A0G4PT60    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-29NNNPACADCKAKKKRCIHRNQPVKVTEHydrophilic
NLS Segment(s)
PositionSequence
67-81TRGRRKAAEAKAKAK
Subcellular Location(s) nucl 16.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MPNNNPACADCKAKKKRCIHRNQPVKVTEAEAVPASMSSPSAPPPPPPPVPTPAATPAPVSPPGAATRGRRKAAEAKAKAKEMSPAPADSSDELSSVPTEAEEKPVVDKPTKRTRRAKTTTPPDLSPDNLLAASTMSVHRVFARELQRNLQELERSMEAFNEAHRDSLAAPQALNEAHRETLAAGQAIQRTVESWIQTWAVSGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.83
4 0.85
5 0.9
6 0.9
7 0.9
8 0.91
9 0.89
10 0.88
11 0.79
12 0.72
13 0.62
14 0.53
15 0.45
16 0.34
17 0.28
18 0.19
19 0.17
20 0.14
21 0.12
22 0.09
23 0.07
24 0.07
25 0.07
26 0.07
27 0.1
28 0.14
29 0.15
30 0.18
31 0.23
32 0.29
33 0.32
34 0.35
35 0.37
36 0.37
37 0.39
38 0.38
39 0.36
40 0.34
41 0.33
42 0.29
43 0.27
44 0.23
45 0.23
46 0.23
47 0.2
48 0.15
49 0.15
50 0.15
51 0.16
52 0.19
53 0.22
54 0.3
55 0.37
56 0.39
57 0.37
58 0.4
59 0.46
60 0.52
61 0.56
62 0.53
63 0.53
64 0.55
65 0.56
66 0.53
67 0.45
68 0.4
69 0.31
70 0.29
71 0.24
72 0.2
73 0.19
74 0.19
75 0.19
76 0.15
77 0.17
78 0.12
79 0.11
80 0.1
81 0.09
82 0.09
83 0.08
84 0.07
85 0.04
86 0.06
87 0.06
88 0.08
89 0.08
90 0.08
91 0.1
92 0.14
93 0.16
94 0.17
95 0.2
96 0.25
97 0.36
98 0.44
99 0.5
100 0.57
101 0.63
102 0.7
103 0.73
104 0.75
105 0.74
106 0.75
107 0.76
108 0.7
109 0.63
110 0.55
111 0.51
112 0.43
113 0.35
114 0.25
115 0.17
116 0.14
117 0.13
118 0.09
119 0.08
120 0.07
121 0.06
122 0.06
123 0.07
124 0.07
125 0.08
126 0.09
127 0.1
128 0.11
129 0.16
130 0.25
131 0.3
132 0.32
133 0.37
134 0.39
135 0.4
136 0.41
137 0.37
138 0.3
139 0.25
140 0.26
141 0.22
142 0.2
143 0.18
144 0.17
145 0.16
146 0.14
147 0.14
148 0.15
149 0.14
150 0.14
151 0.13
152 0.14
153 0.13
154 0.18
155 0.21
156 0.16
157 0.16
158 0.16
159 0.18
160 0.18
161 0.18
162 0.15
163 0.13
164 0.13
165 0.13
166 0.13
167 0.12
168 0.15
169 0.16
170 0.14
171 0.12
172 0.15
173 0.17
174 0.18
175 0.17
176 0.14
177 0.13
178 0.16
179 0.19
180 0.17
181 0.16
182 0.19
183 0.19
184 0.19