Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PB12

Protein Details
Accession A0A0G4PB12   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
14-46PLSMRKRKRSTEHESSRARKKRKPALDDLRKLLBasic
76-96GSVSGKPRRRRGRGCGRPYVFBasic
NLS Segment(s)
PositionSequence
18-37RKRKRSTEHESSRARKKRKP
80-88GKPRRRRGR
Subcellular Location(s) nucl 13.5, cyto_nucl 11, cyto 7.5, mito 4
Family & Domain DBs
Amino Acid Sequences MDASESEYEQPLLPLSMRKRKRSTEHESSRARKKRKPALDDLRKLLVTYHGLQQMQRELDEQLALCEHQIVKHKFGSVSGKPRRRRGRGCGRPYVFPRVRSPLREVVTIEEDLPTFWGRVGEWLWTWW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.24
3 0.34
4 0.41
5 0.49
6 0.56
7 0.64
8 0.72
9 0.74
10 0.76
11 0.77
12 0.79
13 0.79
14 0.81
15 0.8
16 0.81
17 0.81
18 0.79
19 0.73
20 0.74
21 0.75
22 0.75
23 0.75
24 0.75
25 0.78
26 0.81
27 0.81
28 0.75
29 0.68
30 0.58
31 0.51
32 0.4
33 0.32
34 0.24
35 0.2
36 0.21
37 0.2
38 0.21
39 0.21
40 0.22
41 0.22
42 0.2
43 0.18
44 0.15
45 0.12
46 0.12
47 0.12
48 0.1
49 0.07
50 0.06
51 0.06
52 0.05
53 0.06
54 0.05
55 0.07
56 0.16
57 0.18
58 0.2
59 0.21
60 0.23
61 0.22
62 0.25
63 0.29
64 0.26
65 0.35
66 0.42
67 0.49
68 0.54
69 0.64
70 0.71
71 0.73
72 0.75
73 0.76
74 0.78
75 0.8
76 0.82
77 0.82
78 0.75
79 0.73
80 0.7
81 0.7
82 0.63
83 0.56
84 0.54
85 0.52
86 0.54
87 0.51
88 0.53
89 0.5
90 0.48
91 0.47
92 0.43
93 0.38
94 0.37
95 0.34
96 0.28
97 0.21
98 0.18
99 0.16
100 0.17
101 0.13
102 0.1
103 0.1
104 0.1
105 0.09
106 0.13
107 0.14
108 0.15