Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PWS5

Protein Details
Accession A0A0G4PWS5    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-42RDEIKRLREGNRKQTKKRAKSKKQISNIGSHydrophilic
NLS Segment(s)
PositionSequence
17-35KRLREGNRKQTKKRAKSKK
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 9
Family & Domain DBs
Amino Acid Sequences MSVKLVHEHVLMRDEIKRLREGNRKQTKKRAKSKKQISNIGSLTEVPDLTTNTSSKEGSSVRYISDTTPTLEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.24
3 0.25
4 0.27
5 0.27
6 0.36
7 0.44
8 0.49
9 0.56
10 0.63
11 0.7
12 0.72
13 0.8
14 0.83
15 0.83
16 0.85
17 0.86
18 0.85
19 0.87
20 0.91
21 0.9
22 0.87
23 0.86
24 0.77
25 0.73
26 0.63
27 0.53
28 0.42
29 0.33
30 0.26
31 0.17
32 0.15
33 0.08
34 0.09
35 0.08
36 0.1
37 0.12
38 0.11
39 0.13
40 0.15
41 0.15
42 0.14
43 0.18
44 0.17
45 0.18
46 0.23
47 0.21
48 0.21
49 0.22
50 0.23
51 0.2
52 0.24
53 0.23