Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PJY0

Protein Details
Accession A0A0G4PJY0    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MAPAATGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
8-23GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 8.5, cyto_nucl 7.5, mito 7, pero 6, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAATGGKKQKKKWSKGKVKDKAQHAVVLDKATNDKLQKDVQSYRLITVATLVDRLKINGSLARQALNDLEANGQIKKVVGHSSLSIYTRAVTAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.85
3 0.86
4 0.89
5 0.93
6 0.92
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.48
15 0.39
16 0.33
17 0.26
18 0.19
19 0.19
20 0.16
21 0.18
22 0.16
23 0.15
24 0.16
25 0.19
26 0.21
27 0.24
28 0.25
29 0.26
30 0.3
31 0.29
32 0.27
33 0.25
34 0.23
35 0.17
36 0.16
37 0.13
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.1
44 0.1
45 0.09
46 0.1
47 0.11
48 0.12
49 0.15
50 0.15
51 0.16
52 0.15
53 0.15
54 0.15
55 0.14
56 0.13
57 0.1
58 0.1
59 0.1
60 0.12
61 0.11
62 0.11
63 0.1
64 0.1
65 0.1
66 0.11
67 0.14
68 0.14
69 0.16
70 0.17
71 0.2
72 0.23
73 0.24
74 0.23
75 0.19
76 0.19