Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4P937

Protein Details
Accession A0A0G4P937    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
18-37WFSQCSPRRLTRPKKQICGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto 5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR026891  Fn3-like  
IPR013783  Ig-like_fold  
Pfam View protein in Pfam  
PF14310  Fn3-like  
Amino Acid Sequences MSICARYGTVLRENGIAWFSQCSPRRLTRPKKQICGFSKSCPLSPNERQEVEIEVDFHAFGMYDTKQGMWVVDAGAEFEMLQGSKQQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.17
4 0.12
5 0.12
6 0.13
7 0.2
8 0.24
9 0.25
10 0.3
11 0.36
12 0.45
13 0.53
14 0.62
15 0.64
16 0.71
17 0.77
18 0.81
19 0.79
20 0.79
21 0.74
22 0.72
23 0.64
24 0.57
25 0.57
26 0.49
27 0.46
28 0.38
29 0.35
30 0.35
31 0.38
32 0.41
33 0.36
34 0.35
35 0.35
36 0.34
37 0.34
38 0.28
39 0.22
40 0.16
41 0.12
42 0.12
43 0.11
44 0.1
45 0.07
46 0.05
47 0.05
48 0.07
49 0.07
50 0.08
51 0.08
52 0.09
53 0.1
54 0.1
55 0.1
56 0.08
57 0.08
58 0.07
59 0.08
60 0.08
61 0.08
62 0.08
63 0.07
64 0.06
65 0.06
66 0.07
67 0.06
68 0.07