Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0G4PXY4

Protein Details
Accession A0A0G4PXY4   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-34KTTRSKNSSTRKLMHQKQYRRKANMLKKASHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002100  TF_MADSbox  
IPR036879  TF_MADSbox_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046983  F:protein dimerization activity  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00319  SRF-TF  
Amino Acid Sequences MAALKTTRSKNSSTRKLMHQKQYRRKANMLKKASEYSKMCDADVCVGIRMRETGQVHILSADSSGFWAFLISQLSSYYPTPTVMTDRDLEKTREETVSREQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.76
4 0.8
5 0.81
6 0.8
7 0.8
8 0.83
9 0.89
10 0.88
11 0.83
12 0.82
13 0.81
14 0.82
15 0.81
16 0.76
17 0.69
18 0.64
19 0.63
20 0.58
21 0.55
22 0.46
23 0.4
24 0.41
25 0.38
26 0.33
27 0.28
28 0.27
29 0.21
30 0.21
31 0.18
32 0.11
33 0.11
34 0.11
35 0.1
36 0.11
37 0.09
38 0.12
39 0.12
40 0.13
41 0.15
42 0.15
43 0.15
44 0.14
45 0.14
46 0.09
47 0.08
48 0.07
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.06
57 0.08
58 0.07
59 0.08
60 0.08
61 0.09
62 0.11
63 0.12
64 0.12
65 0.11
66 0.12
67 0.13
68 0.14
69 0.17
70 0.16
71 0.18
72 0.19
73 0.2
74 0.25
75 0.28
76 0.28
77 0.28
78 0.3
79 0.3
80 0.32
81 0.31
82 0.31